SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601978|ref|NP_245050.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601978|ref|NP_245050.1|
Domain Number 1 Region: 1-297
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.4e-67
Family PyrH-like 0.000016
Further Details:      
 
Domain Number 2 Region: 614-797
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 5.1e-51
Family Homoserine dehydrogenase-like 0.0000243
Further Details:      
 
Domain Number 3 Region: 463-636
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.42e-37
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0018
Further Details:      
 
Domain Number 4 Region: 302-380
Classification Level Classification E-value
Superfamily ACT-like 7.55e-23
Family Aspartokinase allosteric domain-like 0.0016
Further Details:      
 
Domain Number 5 Region: 387-475
Classification Level Classification E-value
Superfamily ACT-like 7.28e-22
Family Aspartokinase allosteric domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15601978|ref|NP_245050.1|
Sequence length 815
Comment bifunctional aspartokinase I/homoserine dehydrogenase I [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRVLKFGGTSLANPERFSQAAQLIEKAHFEEQAAGVLSAPAKITNHLVALSEKASLNQPT
DANFNEAIEIFYHIIHGLHAENNRFDLEGTKALIDTEFAQISQLLEEIRQQGFVSDAVKA
TIDCRGEKLSIAMMKAWFEARGYDVTVIDPVEKLLAHGSYLESSVDIEESTKRVDAKSIP
TKNVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASACEIWTDVDGVFTCDPRLV
PDARLLPSLSYREAMELSYFGAKVIHPRTIGPLVQTNIPCLIKNTGNPSAPGSIIDGNIQ
SEQLQVKGITNLDNVAMFNVSGPGMQGMVGMASRVFSAMSNAGVSVILITQSSSEYSISF
CVPAKSVEVAKQALEKEFEQELKANDLEPIDVIRDLSIISVVGDGMKQAKGIAARFFSAL
AQANISIVAIAQGSSERSISAVVALNKAIEAVKATHQALFNNKKVVDVFLVGVGGVGGEL
IEQIKHQKSYLAKKDIEIRVCAIANSNKMLLKADGLNLENWQADLETATQPSDFDVLLSF
IKLHHVVNPVFVDCTSADSVAGLYVRALGEGFHVVTPNKKANTRELAYYNALRESARNNQ
RKFLYDTNVGAGLPVIENLQNLLAAGDEVVKFSGVLSGSLSFIFGELENGLTLSEATALA
REKGFTEPDPRDDLSGQDVARKLLILARETGAQLELTDIEVESVLPAGFAEGKTTQEFMA
MLPQLDAEFSQRVANAKAEGKVLRYVGQIENNSCKVSVLEVDADDPLYKVKNGENALAFY
TRYYQPIPLLLRGYGAGNSVTAAGIFADILRTLQH
Download sequence
Identical sequences A0A2J9QXT6 Q9CPD4
WP_010906491.1.12311 WP_010906491.1.15732 WP_010906491.1.19996 WP_010906491.1.21657 WP_010906491.1.24757 WP_010906491.1.26777 WP_010906491.1.36022 WP_010906491.1.40210 WP_010906491.1.40787 WP_010906491.1.41297 WP_010906491.1.45422 WP_010906491.1.4808 WP_010906491.1.51342 WP_010906491.1.53852 WP_010906491.1.57956 WP_010906491.1.6219 WP_010906491.1.62389 WP_010906491.1.66990 WP_010906491.1.8281 WP_010906491.1.89773 WP_010906491.1.95718 WP_010906491.1.9746 WP_010906491.1.9947 272843.PM0113 gi|383310793|ref|YP_005363603.1| gi|15601978|ref|NP_245050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]