SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601979|ref|NP_245051.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601979|ref|NP_245051.1|
Domain Number 1 Region: 177-294
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.73e-32
Family Homoserine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 1-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.02e-32
Family GHMP Kinase, N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601979|ref|NP_245051.1|
Sequence length 314
Comment homoserine kinase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLRIYAPASSANLSVGFDTLGTAVSPIDGSLLGDVVQIEALPSGFELESAGYFVRKLPKE
AQKNIVYQAYVLFSERLKLRNIAVRPLRLTLEKNMPIGSGLGSSACSIVAALVALNKFHA
EPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGVQLMVQSLGNICQQLPFFDEWYWVL
AYPGIEVSTAEARAILPKSYTRQDVISQARHLGSFVHACHTRQAQLAALMMKDVIAEPYR
EALLPNFADVKQATRDLGALATGISGSGPTIFAIAPDLGTAMKLSTYLENHYLQNNEGFV
HICKVDNQGARALD
Download sequence
Identical sequences A0A1D7R6D3 A0A2K2YZ78 Q9CPD3
gi|15601979|ref|NP_245051.1| WP_005720165.1.10027 WP_005720165.1.10721 WP_005720165.1.11014 WP_005720165.1.11214 WP_005720165.1.11947 WP_005720165.1.12156 WP_005720165.1.12311 WP_005720165.1.1307 WP_005720165.1.15732 WP_005720165.1.17217 WP_005720165.1.17980 WP_005720165.1.18123 WP_005720165.1.19996 WP_005720165.1.20287 WP_005720165.1.21657 WP_005720165.1.22153 WP_005720165.1.2313 WP_005720165.1.23830 WP_005720165.1.24757 WP_005720165.1.26616 WP_005720165.1.26777 WP_005720165.1.27416 WP_005720165.1.27592 WP_005720165.1.27664 WP_005720165.1.28084 WP_005720165.1.29697 WP_005720165.1.30617 WP_005720165.1.34253 WP_005720165.1.35562 WP_005720165.1.35978 WP_005720165.1.36022 WP_005720165.1.3807 WP_005720165.1.38246 WP_005720165.1.39152 WP_005720165.1.40210 WP_005720165.1.40787 WP_005720165.1.41462 WP_005720165.1.41657 WP_005720165.1.42469 WP_005720165.1.42512 WP_005720165.1.42943 WP_005720165.1.43687 WP_005720165.1.44741 WP_005720165.1.45422 WP_005720165.1.47685 WP_005720165.1.4808 WP_005720165.1.49053 WP_005720165.1.50853 WP_005720165.1.51342 WP_005720165.1.52066 WP_005720165.1.52859 WP_005720165.1.53852 WP_005720165.1.55074 WP_005720165.1.55401 WP_005720165.1.57420 WP_005720165.1.57956 WP_005720165.1.58111 WP_005720165.1.58257 WP_005720165.1.58450 WP_005720165.1.58628 WP_005720165.1.58910 WP_005720165.1.59455 WP_005720165.1.60478 WP_005720165.1.60664 WP_005720165.1.61860 WP_005720165.1.62016 WP_005720165.1.6219 WP_005720165.1.62389 WP_005720165.1.6332 WP_005720165.1.63549 WP_005720165.1.65482 WP_005720165.1.65878 WP_005720165.1.66934 WP_005720165.1.66990 WP_005720165.1.72215 WP_005720165.1.73917 WP_005720165.1.75804 WP_005720165.1.78987 WP_005720165.1.79347 WP_005720165.1.79593 WP_005720165.1.80223 WP_005720165.1.80589 WP_005720165.1.80911 WP_005720165.1.81885 WP_005720165.1.8281 WP_005720165.1.83579 WP_005720165.1.86541 WP_005720165.1.87897 WP_005720165.1.89773 WP_005720165.1.90081 WP_005720165.1.90179 WP_005720165.1.90578 WP_005720165.1.91495 WP_005720165.1.92478 WP_005720165.1.93940 WP_005720165.1.94432 WP_005720165.1.94435 WP_005720165.1.95718 WP_005720165.1.9746 WP_005720165.1.9947 272843.PM0114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]