SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601985|ref|NP_245057.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601985|ref|NP_245057.1|
Domain Number 1 Region: 16-451
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 6.67e-120
Family Putative modulator of DNA gyrase, PmbA/TldD 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15601985|ref|NP_245057.1|
Sequence length 451
Comment hypothetical protein PM0120 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQNTEKSTALLKQQEQTLREAVRYAVDLAQKAGATAEVAVTKVSGLSVSTRLQEIENVEF
TNDGALGISVYLGNQKGNASTSDLSPEAIKNTVEAAISIAKYASPDECAGLADYDLMAFD
APDLALYHAADIDVEKATALALETEQAALSYDKRIVNSEGSAFNSHTGVRVYGNTHGMLQ
SYLSSRYSLSCSVIAGVEDQLERDYEYTISRDLNQLESASWVGEHCAKKTLSRLQPQKMA
TQQVPVIFLNDVATGLISHLTAAISGGSLYRKSSFLLDHLGKQVLPDWFHISEQPHLIGQ
LASSPFDSEGVRTQCREIIQQGTLQTYLLTSYSGKKLGMRSTGHAGGIHNWLVKPNTTGG
LTTLLRQMGTGLLVTDLMGQGVNLVTGDYSRGAAGFWVENGEIQYPVAEITIAGQLKEML
RNIVAVGDDIEHRSNIQTGSILLEHLKVSGN
Download sequence
Identical sequences Q9CPC7
272843.PM0120 gi|15601985|ref|NP_245057.1| WP_010906495.1.12311 WP_010906495.1.15732 WP_010906495.1.19996 WP_010906495.1.62389 WP_010906495.1.66990 WP_010906495.1.81885 WP_010906495.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]