SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601989|ref|NP_245061.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601989|ref|NP_245061.1|
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.53e-63
Family Phosphate binding protein-like 0.0000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15601989|ref|NP_245061.1|
Sequence length 240
Comment hypothetical protein PM0124 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLLLTALLASTALAANAKEITFAMEPSYPPFELTNEKGEIIGFDVDIANAICKEIQAT
CHFKGQAFDSLITGLRSKHFDAAISAIDITEARAKQVSFSDPYYDSSSSFISVKGKVDDL
AQAKKVGVQNGTTYQQYIVAEAKQYQPVPYASLQNAILDLKNGRIDVIFGDTAVLVDMLA
KEQSLAFVGDKVTNKKYFGNGFGIAVNKASKDLLDDLNKGLATIKANGEYQKIYDKWMTK
Download sequence
Identical sequences A0A1D7R2W7 Q9CPC4 V4NDP8
WP_005722718.1.10027 WP_005722718.1.10721 WP_005722718.1.11214 WP_005722718.1.11947 WP_005722718.1.12156 WP_005722718.1.12311 WP_005722718.1.1307 WP_005722718.1.15732 WP_005722718.1.17217 WP_005722718.1.17980 WP_005722718.1.18123 WP_005722718.1.19996 WP_005722718.1.20287 WP_005722718.1.22153 WP_005722718.1.2313 WP_005722718.1.23830 WP_005722718.1.26616 WP_005722718.1.26777 WP_005722718.1.27416 WP_005722718.1.28084 WP_005722718.1.29697 WP_005722718.1.30617 WP_005722718.1.34253 WP_005722718.1.35562 WP_005722718.1.35978 WP_005722718.1.36022 WP_005722718.1.3807 WP_005722718.1.38246 WP_005722718.1.3839 WP_005722718.1.39152 WP_005722718.1.40210 WP_005722718.1.41351 WP_005722718.1.41462 WP_005722718.1.41667 WP_005722718.1.42943 WP_005722718.1.43687 WP_005722718.1.44741 WP_005722718.1.45422 WP_005722718.1.47685 WP_005722718.1.4808 WP_005722718.1.49053 WP_005722718.1.50853 WP_005722718.1.52066 WP_005722718.1.52585 WP_005722718.1.52859 WP_005722718.1.53852 WP_005722718.1.55074 WP_005722718.1.55401 WP_005722718.1.57420 WP_005722718.1.58111 WP_005722718.1.58257 WP_005722718.1.58450 WP_005722718.1.58628 WP_005722718.1.58910 WP_005722718.1.59455 WP_005722718.1.60478 WP_005722718.1.60664 WP_005722718.1.61860 WP_005722718.1.62016 WP_005722718.1.6219 WP_005722718.1.62389 WP_005722718.1.6332 WP_005722718.1.63549 WP_005722718.1.65482 WP_005722718.1.65878 WP_005722718.1.66934 WP_005722718.1.66990 WP_005722718.1.70689 WP_005722718.1.72215 WP_005722718.1.73917 WP_005722718.1.74955 WP_005722718.1.75804 WP_005722718.1.78987 WP_005722718.1.79347 WP_005722718.1.79593 WP_005722718.1.80223 WP_005722718.1.80589 WP_005722718.1.80911 WP_005722718.1.81885 WP_005722718.1.8281 WP_005722718.1.83579 WP_005722718.1.86541 WP_005722718.1.87897 WP_005722718.1.88402 WP_005722718.1.89773 WP_005722718.1.90081 WP_005722718.1.90179 WP_005722718.1.91495 WP_005722718.1.92478 WP_005722718.1.93940 WP_005722718.1.94435 WP_005722718.1.95718 WP_005722718.1.9746 WP_005722718.1.9947 gi|378774807|ref|YP_005177050.1| 272843.PM0124 gi|15601989|ref|NP_245061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]