SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602002|ref|NP_245074.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602002|ref|NP_245074.1|
Domain Number 1 Region: 102-334
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 6.8e-78
Family MurCDEF 0.000000215
Further Details:      
 
Domain Number 2 Region: 335-487
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.04e-52
Family MurCDEF C-terminal domain 0.00000459
Further Details:      
 
Domain Number 3 Region: 12-100
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 2.35e-24
Family MurE/MurF N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602002|ref|NP_245074.1|
Sequence length 494
Comment UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRRLTALLGQVELAPNIELTEMILDSRAVKQGCLFVALQGHQVDGRQYIPQAIAKGASAV
LAETEDAQQHLSTKIEQGVPIISFYQLGSHLSALAGLFYDNPSHKLTLVGVTGTNGKTTI
SQLLAQWTTLLGHRSAVMGTIGNGLLGQVKEATNTTGSAVEVQASLADFVKRGADFAAIE
VSSHGLVQHRVEALAFDVAIFTNLSRDHLDYHQSMENYALAKKRLFTELNSRHQIINADD
SVGQTWLQEQPNAVAVSCQTDFKPHQARWLKATAIQFSQKGARIQFESSWGKGELHSALI
GQFNVSNLLLVFATLLSLGYDIEKLMKTVPQLTGVCGRMERLSASNQPTAIVDYAHTPDA
LEKALQAARLHCQGKLWCVFGCGGDRDRGKRPIMAKIAEQFADHVIVTDDNPRTESAAQI
VQDILAGFEHPQHVEVCHARDQAIIQALQKADSDDVVLIAGKGHEDYQIIGTQKQHFSDQ
ETVQQYFKVNHHHA
Download sequence
Identical sequences P57815
272843.PM0137 gi|15602002|ref|NP_245074.1| WP_010906500.1.12311 WP_010906500.1.15732 WP_010906500.1.19996 WP_010906500.1.40210 WP_010906500.1.45422 WP_010906500.1.4808 WP_010906500.1.53852 WP_010906500.1.6219 WP_010906500.1.62389 WP_010906500.1.66990 WP_010906500.1.81885 WP_010906500.1.8281 WP_010906500.1.89773 WP_010906500.1.9746 WP_010906500.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]