SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602003|ref|NP_245075.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602003|ref|NP_245075.1|
Domain Number 1 Region: 102-313
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.66e-54
Family MurCDEF 0.00000161
Further Details:      
 
Domain Number 2 Region: 318-454
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.42e-31
Family MurCDEF C-terminal domain 0.0000923
Further Details:      
 
Domain Number 3 Region: 1-98
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 1.57e-24
Family MurE/MurF N-terminal domain 0.0000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602003|ref|NP_245075.1|
Sequence length 460
Comment hypothetical protein PM0138 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLKLTTKQLATILQAELVGEANVVVENISTDTRQRVASSLFFALKGEHFDAHNYLDKAVA
QGANALVVERADTQISVPQLIVKDTRIALGELAKWVKQQVNPRTLAMTGSSGKTTVKEMT
ASILQSAVGVEQVLFTQGNFNNDIGVPLTLLRLTEQHQFAVIELGANHQGEIAYTTGLVQ
PNVALVNNVAAAHLEGFGSLEGVATAKGEIYRGLQPDGVAIINKEHDYRSTWAQDIGAHR
VQYFAYQDNTADFYADNVIFHEAGSTFDLCTPQGKTTIHLPYLGEHNVKNALAASALAMN
VGATLAQIKQGLEVRTQVKGRLYPVQPCDNLLLLDDTYNANVDSLQSAIRVLQKYDAFRI
LVVGDMAELGENSQICHQQVAECAKAAKLERVYSFGSESAVISQACLGKHFTDKALLCRE
LTQLLSEKLKENQKIVLLAKGSRRMQMEDVINTLRENFVC
Download sequence
Identical sequences Q9CPB1
gi|386834759|ref|YP_006240076.1| 272843.PM0138 WP_010906501.1.12311 WP_010906501.1.15732 WP_010906501.1.19996 WP_010906501.1.27592 WP_010906501.1.40210 WP_010906501.1.41657 WP_010906501.1.42512 WP_010906501.1.45422 WP_010906501.1.4808 WP_010906501.1.53852 WP_010906501.1.6219 WP_010906501.1.62389 WP_010906501.1.66990 WP_010906501.1.81885 WP_010906501.1.8281 WP_010906501.1.89773 WP_010906501.1.9746 WP_010906501.1.9947 gi|15602003|ref|NP_245075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]