SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602013|ref|NP_245085.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602013|ref|NP_245085.1|
Domain Number 1 Region: 135-278
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-55
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00016
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.02e-42
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602013|ref|NP_245085.1|
Sequence length 305
Comment UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIKQRTLKQSIKVTGVGLHSGNKVTLTLRPAMANTGVIYCRTDLNPPVTFPANANAVRDT
MLCTCLVNEEGVRISTVEHLNAALAGLGIDNVIIEVDAPEIPIMDGSASPFIYLLLDAGI
EEQNAAKKFIRIKQKVRVEDGDKWAEFTPYNGFRLDFTIDFEHPAIGKDVRNYVMDFSAQ
AFVQQISRARTFGFMKDIEYLQSQGLALGGSLDNAIVLDDYRILNEDGLRFKDELVRHKM
LDAIGDLYMAGYNIIGDFKAYKSGHGLNNKLLRAVLANQEAWEFVTFDDKQAVPHGYEAP
TQVLI
Download sequence
Identical sequences A0A1D2NSN0 J4SPX7 Q9CPA5
gi|386834748|ref|YP_006240065.1| WP_005723052.1.11214 WP_005723052.1.11947 WP_005723052.1.12156 WP_005723052.1.12311 WP_005723052.1.14908 WP_005723052.1.15732 WP_005723052.1.19996 WP_005723052.1.21657 WP_005723052.1.26777 WP_005723052.1.27592 WP_005723052.1.28084 WP_005723052.1.35562 WP_005723052.1.36022 WP_005723052.1.3807 WP_005723052.1.38246 WP_005723052.1.3839 WP_005723052.1.3957 WP_005723052.1.40210 WP_005723052.1.41351 WP_005723052.1.41657 WP_005723052.1.41667 WP_005723052.1.4211 WP_005723052.1.42512 WP_005723052.1.43687 WP_005723052.1.45422 WP_005723052.1.4808 WP_005723052.1.49053 WP_005723052.1.51342 WP_005723052.1.52585 WP_005723052.1.52859 WP_005723052.1.53852 WP_005723052.1.55074 WP_005723052.1.55401 WP_005723052.1.57956 WP_005723052.1.58111 WP_005723052.1.58257 WP_005723052.1.60478 WP_005723052.1.61098 WP_005723052.1.6219 WP_005723052.1.62389 WP_005723052.1.6332 WP_005723052.1.63549 WP_005723052.1.66990 WP_005723052.1.70689 WP_005723052.1.72215 WP_005723052.1.78987 WP_005723052.1.79347 WP_005723052.1.81885 WP_005723052.1.8281 WP_005723052.1.83579 WP_005723052.1.88402 WP_005723052.1.89773 WP_005723052.1.92478 WP_005723052.1.93940 WP_005723052.1.94432 WP_005723052.1.95718 WP_005723052.1.9746 WP_005723052.1.9947 gi|15602013|ref|NP_245085.1| 272843.PM0148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]