SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602015|ref|NP_245087.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602015|ref|NP_245087.1|
Domain Number 1 Region: 105-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-52
Family Phosphate binding protein-like 0.00014
Further Details:      
 
Domain Number 2 Region: 280-378
Classification Level Classification E-value
Superfamily ACT-like 7.12e-27
Family Phenylalanine metabolism regulatory domain 0.023
Further Details:      
 
Domain Number 3 Region: 4-92
Classification Level Classification E-value
Superfamily Chorismate mutase II 1.83e-19
Family Dimeric chorismate mutase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602015|ref|NP_245087.1|
Sequence length 387
Comment hypothetical protein PM0150 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSLDLSEIRQQITQLDRNLLKLLSERHRLAFDVARSKEITQKPLRDLEREQQLLQELIQF
AENQNYQLEAQYITDIFQRIIEDSVATQQVYLQKKLNAQREQNIHIAFLGKRGSYSHLAA
RSYATRYQETFVELSCRSFDEIFEKVSAGEADYGVLPLENTTSGAINEVYDLLQHTDLSL
VGELAYPIRHCVLVNGQDDLNQIETLYSHPQVIQQCSQFIKGLERVHIEYCESSSHAMQL
VASLNKPNIAALGNADGGALYGLTVLKSDIANQPNNITRFIVVAKKPLQVSPQIHTKTLL
LMTTSQQAGALVDALFVFKKHQINMTKLESRPIYGKPWEEMFYLEIEANIHNPETQQALD
ELKQYSHYLKVLGCYPSEIIKPVELTP
Download sequence
Identical sequences A0A1E3XJ02 A0A2K2YYZ2 Q9CPA3 V4NDS3
272843.PM0150 gi|15602015|ref|NP_245087.1| WP_010906505.1.10027 WP_010906505.1.10721 WP_010906505.1.12311 WP_010906505.1.1307 WP_010906505.1.14908 WP_010906505.1.15732 WP_010906505.1.18123 WP_010906505.1.19996 WP_010906505.1.20287 WP_010906505.1.21657 WP_010906505.1.22153 WP_010906505.1.2313 WP_010906505.1.23830 WP_010906505.1.24757 WP_010906505.1.26616 WP_010906505.1.26777 WP_010906505.1.27416 WP_010906505.1.27664 WP_010906505.1.29697 WP_010906505.1.30617 WP_010906505.1.34253 WP_010906505.1.35978 WP_010906505.1.36022 WP_010906505.1.39152 WP_010906505.1.3957 WP_010906505.1.40210 WP_010906505.1.40787 WP_010906505.1.41351 WP_010906505.1.41462 WP_010906505.1.41667 WP_010906505.1.42943 WP_010906505.1.44741 WP_010906505.1.45422 WP_010906505.1.47685 WP_010906505.1.4808 WP_010906505.1.50853 WP_010906505.1.51342 WP_010906505.1.52066 WP_010906505.1.53852 WP_010906505.1.57420 WP_010906505.1.58111 WP_010906505.1.58450 WP_010906505.1.58628 WP_010906505.1.58910 WP_010906505.1.59455 WP_010906505.1.60664 WP_010906505.1.61098 WP_010906505.1.61860 WP_010906505.1.62016 WP_010906505.1.6219 WP_010906505.1.62389 WP_010906505.1.65482 WP_010906505.1.65878 WP_010906505.1.66934 WP_010906505.1.66990 WP_010906505.1.73917 WP_010906505.1.74955 WP_010906505.1.75804 WP_010906505.1.80223 WP_010906505.1.80589 WP_010906505.1.80911 WP_010906505.1.81885 WP_010906505.1.8281 WP_010906505.1.86541 WP_010906505.1.87897 WP_010906505.1.88402 WP_010906505.1.89773 WP_010906505.1.90081 WP_010906505.1.90179 WP_010906505.1.91495 WP_010906505.1.94435 WP_010906505.1.95718 WP_010906505.1.9746 WP_010906505.1.9947 gi|378774781|ref|YP_005177024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]