SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602016|ref|NP_245088.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602016|ref|NP_245088.1|
Domain Number 1 Region: 60-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-92
Family L-arabinose binding protein-like 0.00000122
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.78e-17
Family GalR/LacI-like bacterial regulator 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602016|ref|NP_245088.1|
Sequence length 337
Comment protein RbsR [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MATMKDIARIAKVSTSTVSHVINNSRFVSDEIRDKVMHVVKELNYTPSALARSLKVKETK
TIGLLVTATNNPFFTEVVSGVEQYCHQHHYNLILSNTEGDTERLRHNLQTLIQKQVDGLL
LMCSDARIQIGKDLNVNLPFVVMDWWPTEEKADKIYENSEYGGYLATKQLIEKGHQHIAI
ITGNLKKSLAQNRLDGYKKALKEANIPLREDCIIESHFDFEGGKRGMEKVLALQPRPTAV
FACSDSIAFGAYQTVWHQGLHIPQDISIIGYDNITLAEYMSPPLTTINQPKAELGKLAVE
TLLQRIKNPTAKHRTLLLEPQLVWRESVRQLYQEKRG
Download sequence
Identical sequences A0A1E3XIZ9 A0A2K2YXW5 J5L3A1 Q9CPA2 V4NJ57
WP_005720235.1.10721 WP_005720235.1.11014 WP_005720235.1.11214 WP_005720235.1.11947 WP_005720235.1.12156 WP_005720235.1.12311 WP_005720235.1.1307 WP_005720235.1.14908 WP_005720235.1.15732 WP_005720235.1.17217 WP_005720235.1.18123 WP_005720235.1.19996 WP_005720235.1.2313 WP_005720235.1.23830 WP_005720235.1.26616 WP_005720235.1.26777 WP_005720235.1.27416 WP_005720235.1.27664 WP_005720235.1.28084 WP_005720235.1.30617 WP_005720235.1.35562 WP_005720235.1.3807 WP_005720235.1.38246 WP_005720235.1.3839 WP_005720235.1.3957 WP_005720235.1.40210 WP_005720235.1.41351 WP_005720235.1.41667 WP_005720235.1.42469 WP_005720235.1.42943 WP_005720235.1.43687 WP_005720235.1.45422 WP_005720235.1.47685 WP_005720235.1.4808 WP_005720235.1.49053 WP_005720235.1.50853 WP_005720235.1.52585 WP_005720235.1.52859 WP_005720235.1.53852 WP_005720235.1.55401 WP_005720235.1.58111 WP_005720235.1.58257 WP_005720235.1.58628 WP_005720235.1.58910 WP_005720235.1.59455 WP_005720235.1.60478 WP_005720235.1.61098 WP_005720235.1.6219 WP_005720235.1.62389 WP_005720235.1.6332 WP_005720235.1.63549 WP_005720235.1.66990 WP_005720235.1.70689 WP_005720235.1.72215 WP_005720235.1.73917 WP_005720235.1.74955 WP_005720235.1.78987 WP_005720235.1.79347 WP_005720235.1.80223 WP_005720235.1.80911 WP_005720235.1.81885 WP_005720235.1.8281 WP_005720235.1.83579 WP_005720235.1.86541 WP_005720235.1.88402 WP_005720235.1.89773 WP_005720235.1.90081 WP_005720235.1.90578 WP_005720235.1.92478 WP_005720235.1.93940 WP_005720235.1.94435 WP_005720235.1.9746 WP_005720235.1.9947 gi|15602016|ref|NP_245088.1| gi|378774780|ref|YP_005177023.1| 272843.PM0151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]