SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602018|ref|NP_245090.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602018|ref|NP_245090.1|
Domain Number 1 Region: 11-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.21e-83
Family L-arabinose binding protein-like 0.00000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602018|ref|NP_245090.1|
Sequence length 295
Comment D-ribose transporter subunit RbsB [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLQKLTTLASALMLSLAVSGTALAKETIALAVSTLDNPFFVTLKDGAQKKADELGYKL
VVLDSQNDPAKELANVEDLTVRGVKVLLINPTDSEAVVNAVKMANRNKIPVITLDRGAVA
GDVVSHIASDNVAGGKMAGDFIAEKLGAGAKVIQLEGIAGTSAARERGEGFKQAIDAHKF
DVLASQPADFDRTKGLNVMENLLASKGDVKAVFAQNDEMALGALRAINAANKKVLVVGFD
GTDDGVKAVQTGKMAATIAQQPDLIGALGVVTADKVLKGEKVEAKIPVDLKVIHK
Download sequence
Identical sequences A0A1D7R2T1 A0A2K2YY09 Q9CPA0 V4MVX4
gi|383310752|ref|YP_005363562.1| WP_005723060.1.10027 WP_005723060.1.10721 WP_005723060.1.11014 WP_005723060.1.12311 WP_005723060.1.1307 WP_005723060.1.14908 WP_005723060.1.15732 WP_005723060.1.17217 WP_005723060.1.17980 WP_005723060.1.18123 WP_005723060.1.19996 WP_005723060.1.20287 WP_005723060.1.22153 WP_005723060.1.2313 WP_005723060.1.23830 WP_005723060.1.24757 WP_005723060.1.26616 WP_005723060.1.26777 WP_005723060.1.27416 WP_005723060.1.27592 WP_005723060.1.27664 WP_005723060.1.29697 WP_005723060.1.30617 WP_005723060.1.34253 WP_005723060.1.35978 WP_005723060.1.36022 WP_005723060.1.39152 WP_005723060.1.3957 WP_005723060.1.40210 WP_005723060.1.40787 WP_005723060.1.41297 WP_005723060.1.41351 WP_005723060.1.41462 WP_005723060.1.41657 WP_005723060.1.41667 WP_005723060.1.4211 WP_005723060.1.42469 WP_005723060.1.42512 WP_005723060.1.42943 WP_005723060.1.44741 WP_005723060.1.45422 WP_005723060.1.47685 WP_005723060.1.4808 WP_005723060.1.50853 WP_005723060.1.52066 WP_005723060.1.53852 WP_005723060.1.55074 WP_005723060.1.57420 WP_005723060.1.57956 WP_005723060.1.58111 WP_005723060.1.58450 WP_005723060.1.58628 WP_005723060.1.58910 WP_005723060.1.59455 WP_005723060.1.60664 WP_005723060.1.61098 WP_005723060.1.61860 WP_005723060.1.62016 WP_005723060.1.6219 WP_005723060.1.62389 WP_005723060.1.65482 WP_005723060.1.65878 WP_005723060.1.66934 WP_005723060.1.66990 WP_005723060.1.70689 WP_005723060.1.73917 WP_005723060.1.74955 WP_005723060.1.75804 WP_005723060.1.79593 WP_005723060.1.80223 WP_005723060.1.80589 WP_005723060.1.80911 WP_005723060.1.81885 WP_005723060.1.8281 WP_005723060.1.86541 WP_005723060.1.87897 WP_005723060.1.88402 WP_005723060.1.89773 WP_005723060.1.90081 WP_005723060.1.90179 WP_005723060.1.90578 WP_005723060.1.91495 WP_005723060.1.92478 WP_005723060.1.93940 WP_005723060.1.94432 WP_005723060.1.94435 WP_005723060.1.95718 WP_005723060.1.9746 WP_005723060.1.9947 gi|15602018|ref|NP_245090.1| gi|378774778|ref|YP_005177021.1| 272843.PM0153 gi|386834743|ref|YP_006240060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]