SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602030|ref|NP_245102.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602030|ref|NP_245102.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Bet v1-like 1.9e-32
Family oligoketide cyclase/dehydrase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602030|ref|NP_245102.1|
Sequence length 146
Comment hypothetical protein PM0165 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MPTINQSALVPYSAAQMYQLVNNYERYPEFVPGCVNGRTLTQNGHELTAELVISKAGIRQ
QFTTRNQMVENRSIKMQLVEGPFRFLQGEWQFDELDECCCKIALKLEFEFSNPLIAMAFG
QIFTHLTSKMIDAFKQRAREVYHGAN
Download sequence
Identical sequences A0A1D7R2R3 A0A2K2YYE5 Q9CP89 V4NFD2
gi|378774766|ref|YP_005177009.1| gi|383310739|ref|YP_005363549.1| gi|15602030|ref|NP_245102.1| gi|386834730|ref|YP_006240047.1| WP_005723398.1.10027 WP_005723398.1.10721 WP_005723398.1.11014 WP_005723398.1.11214 WP_005723398.1.11947 WP_005723398.1.12156 WP_005723398.1.1307 WP_005723398.1.17217 WP_005723398.1.17980 WP_005723398.1.18123 WP_005723398.1.19996 WP_005723398.1.20287 WP_005723398.1.22153 WP_005723398.1.2313 WP_005723398.1.23830 WP_005723398.1.24757 WP_005723398.1.26616 WP_005723398.1.27416 WP_005723398.1.27592 WP_005723398.1.27664 WP_005723398.1.28084 WP_005723398.1.29697 WP_005723398.1.30617 WP_005723398.1.34253 WP_005723398.1.35562 WP_005723398.1.35978 WP_005723398.1.3807 WP_005723398.1.38246 WP_005723398.1.3839 WP_005723398.1.39152 WP_005723398.1.40210 WP_005723398.1.40787 WP_005723398.1.41297 WP_005723398.1.41351 WP_005723398.1.41462 WP_005723398.1.41657 WP_005723398.1.41667 WP_005723398.1.4211 WP_005723398.1.42469 WP_005723398.1.42512 WP_005723398.1.42943 WP_005723398.1.43687 WP_005723398.1.44741 WP_005723398.1.45422 WP_005723398.1.47685 WP_005723398.1.4808 WP_005723398.1.49053 WP_005723398.1.52066 WP_005723398.1.52585 WP_005723398.1.52859 WP_005723398.1.53852 WP_005723398.1.55074 WP_005723398.1.55401 WP_005723398.1.57420 WP_005723398.1.57956 WP_005723398.1.58111 WP_005723398.1.58257 WP_005723398.1.58450 WP_005723398.1.58628 WP_005723398.1.58910 WP_005723398.1.59455 WP_005723398.1.60478 WP_005723398.1.60664 WP_005723398.1.61860 WP_005723398.1.62016 WP_005723398.1.6219 WP_005723398.1.6332 WP_005723398.1.63549 WP_005723398.1.65482 WP_005723398.1.65878 WP_005723398.1.66934 WP_005723398.1.66990 WP_005723398.1.70689 WP_005723398.1.72215 WP_005723398.1.73917 WP_005723398.1.74955 WP_005723398.1.75804 WP_005723398.1.78987 WP_005723398.1.79347 WP_005723398.1.79593 WP_005723398.1.80223 WP_005723398.1.80589 WP_005723398.1.80911 WP_005723398.1.8281 WP_005723398.1.83579 WP_005723398.1.86541 WP_005723398.1.87897 WP_005723398.1.88402 WP_005723398.1.89773 WP_005723398.1.90081 WP_005723398.1.90179 WP_005723398.1.90578 WP_005723398.1.91495 WP_005723398.1.92478 WP_005723398.1.93940 WP_005723398.1.94432 WP_005723398.1.94435 WP_005723398.1.9746 WP_005723398.1.9947 272843.PM0165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]