SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602047|ref|NP_245119.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602047|ref|NP_245119.1|
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.74e-63
Family Tyrosine-dependent oxidoreductases 0.00000000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602047|ref|NP_245119.1|
Sequence length 260
Comment protein FabI [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MGFLTNKRILIAGVASNRSIAYGIAQAMKREGAELAFTYQNDKLKGRVEEFAKELGSDIV
IPCDVGTDESIEQCFAELAKHWEKFDGFVHSIAFAPGDQLDGDYVDAVNREGFRIAHDVS
SYSFVAMAKAARGMLNPNSALLTLSYLGAERAIPNYNVMGLAKASLEANTRFMAAALGKD
GIRVNAISAGPIRTLAASGIKNFKKMLANFEQTAPLRRTVTIEDVGNSAAFLCSDLSAGI
TGEVVHVDAGFSIVAMGELE
Download sequence
Identical sequences A0A126QDL7 A0A2K2YZD6 Q9CP73 V4N7T5
272843.PM0182 gi|378774749|ref|YP_005176992.1| WP_005753491.1.10027 WP_005753491.1.10721 WP_005753491.1.12311 WP_005753491.1.1307 WP_005753491.1.14908 WP_005753491.1.15732 WP_005753491.1.17217 WP_005753491.1.18123 WP_005753491.1.20287 WP_005753491.1.21657 WP_005753491.1.22153 WP_005753491.1.2313 WP_005753491.1.23830 WP_005753491.1.24757 WP_005753491.1.26616 WP_005753491.1.26777 WP_005753491.1.27416 WP_005753491.1.27664 WP_005753491.1.29697 WP_005753491.1.30617 WP_005753491.1.34253 WP_005753491.1.35978 WP_005753491.1.36022 WP_005753491.1.39152 WP_005753491.1.3957 WP_005753491.1.40210 WP_005753491.1.40787 WP_005753491.1.41462 WP_005753491.1.4211 WP_005753491.1.42943 WP_005753491.1.44741 WP_005753491.1.45422 WP_005753491.1.47685 WP_005753491.1.4808 WP_005753491.1.50853 WP_005753491.1.51342 WP_005753491.1.52066 WP_005753491.1.53852 WP_005753491.1.55074 WP_005753491.1.57420 WP_005753491.1.58450 WP_005753491.1.58628 WP_005753491.1.58910 WP_005753491.1.59455 WP_005753491.1.60664 WP_005753491.1.61098 WP_005753491.1.61860 WP_005753491.1.62016 WP_005753491.1.6219 WP_005753491.1.62389 WP_005753491.1.65482 WP_005753491.1.65878 WP_005753491.1.66934 WP_005753491.1.66990 WP_005753491.1.73917 WP_005753491.1.74955 WP_005753491.1.75804 WP_005753491.1.79593 WP_005753491.1.80223 WP_005753491.1.80589 WP_005753491.1.80911 WP_005753491.1.81885 WP_005753491.1.8281 WP_005753491.1.86541 WP_005753491.1.87897 WP_005753491.1.89773 WP_005753491.1.90081 WP_005753491.1.90179 WP_005753491.1.91495 WP_005753491.1.94435 WP_005753491.1.95718 WP_005753491.1.9746 WP_005753491.1.9947 gi|15602047|ref|NP_245119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]