SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602051|ref|NP_245123.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602051|ref|NP_245123.1|
Domain Number 1 Region: 9-217
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.84e-61
Family N-type ATP pyrophosphatases 0.00000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602051|ref|NP_245123.1|
Sequence length 228
Comment hypothetical protein PM0186 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQLTNPNRDRKAVVIFSGGQDSTTCLFQAIQDYGVENVEVVTFQYGQRHAIELEKAKWIA
QDLGVKQTLIDTSVIKAITQNALMDEQARIEQHGSTPNTFVDGRNALFLLYTAIYAKGQG
IQDIITGVCETDFSGYPDCRDVFIKSMNVTLNLAMDYQFHLKTPLMYLTKAQTWQLADEL
GVLDYIRQHTHTCYMGVEQGCGECPSCVLREKGLREYLSSKSEAEIDV
Download sequence
Identical sequences Q9CP69
WP_010906517.1.12311 WP_010906517.1.15732 WP_010906517.1.19996 WP_010906517.1.40210 WP_010906517.1.45422 WP_010906517.1.4808 WP_010906517.1.53852 WP_010906517.1.6219 WP_010906517.1.62389 WP_010906517.1.66990 WP_010906517.1.81885 WP_010906517.1.8281 WP_010906517.1.89773 WP_010906517.1.9746 WP_010906517.1.9947 gi|15602051|ref|NP_245123.1| 272843.PM0186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]