SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602057|ref|NP_245129.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602057|ref|NP_245129.1|
Domain Number 1 Region: 44-460
Classification Level Classification E-value
Superfamily DHH phosphoesterases 1.96e-115
Family Exonuclease RecJ 0.00000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602057|ref|NP_245129.1|
Sequence length 573
Comment hypothetical protein PM0192 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNKLIQRRAVPLGEAVSSDPLLDRLYRARQIQHPQQLDRTLAALLHPQQLDGIEAAVTLF
VQAYKQQEKIVIVGDFDADGATSTALAVLALRQLGFTQVAFLIPNRFEQGYGLSIAVAEQ
ALEKDVQLLMTVDNGVSSVEGVAFLKAQGVKVLITDHHLPPTQLPDADAIVNPNLSSCAF
PSKALAGVGVTFYLMLALRAKFRELGIFNQQTQPNFTDLLDLVALGTIADVVPLDQNNRI
LAYQGLARIRAERCRCGIRALAEVANRDMRQLSTSDLGFSLAPRLNAAGRLDNMSVGVEL
LLAEDMASARALALELDGLNQTRKEIEQGMKLEALEICRQLTALQQTLPFGIALYQADWH
QGVLGIVASRIKDHFHRPVVAFAQEQAGILKGSARSVEGLHLRDALERIHCLYPDMILKF
GGHAMAAGLTIQESRFADFQQAFNQIVGDWLDEGQRQGIVWTDGELDSVQLSLTTAECLK
EAGPWGQAFPEPVFDGEFKILQQRLVGEKHLKMMVEPKQGGPLLDAIAFNVDTRYYPDLS
IKLAKLAYKLDINEFRGNRHLQLLVDYIVPIGT
Download sequence
Identical sequences Q9CP64
WP_005723439.1.12311 WP_005723439.1.15732 WP_005723439.1.19996 WP_005723439.1.21657 WP_005723439.1.40210 WP_005723439.1.41351 WP_005723439.1.41667 WP_005723439.1.45422 WP_005723439.1.4808 WP_005723439.1.51342 WP_005723439.1.53852 WP_005723439.1.58111 WP_005723439.1.6219 WP_005723439.1.62389 WP_005723439.1.66990 WP_005723439.1.70689 WP_005723439.1.81885 WP_005723439.1.8281 WP_005723439.1.88402 WP_005723439.1.89773 WP_005723439.1.92478 WP_005723439.1.93940 WP_005723439.1.9746 WP_005723439.1.9947 gi|15602057|ref|NP_245129.1| 272843.PM0192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]