SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602069|ref|NP_245141.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602069|ref|NP_245141.1|
Domain Number 1 Region: 381-863
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.53e-149
Family Aconitase iron-sulfur domain 0.0000000000000981
Further Details:      
 
Domain Number 2 Region: 165-375
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.65e-71
Family LeuD-like 0.0000000116
Further Details:      
 
Domain Number 3 Region: 4-163
Classification Level Classification E-value
Superfamily Aconitase B, N-terminal domain 4.05e-65
Family Aconitase B, N-terminal domain 0.000000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602069|ref|NP_245141.1|
Sequence length 868
Comment bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSDFLQSYQQHVDERAALGIVPKPLDAEQTAQLIELLKNPPADKADFLLNLFETRIPAGV
DEAAYVKASFLAAVAKRDVQSLLISAEKAVQLLGTMQGGYNIEPLLHALDDETLAPIAVE
ALSTTLLMFDNFHDVAERAKKGNLFAKQVLTSWANADWFLSRPKLAEKLTVTVFKVTGET
NTDDLSPAQDAWSRPDIPLHALAMLKNTRDGIEPDDAGNVGPIKQLEQLKQKGFPLAYVG
DVVGTGSSRKSATNSVLWFMGEDIPYIPNKRAGGVVLGGKIAPIFFNTMEDAGSLPIEVD
VSELNMGDVIDIYPYQGKICRHDTDEVLAEFSLKTNVLLDEVRAGGRIPLIIGRGLTHKA
RCELGLPESDIFAKPQCSTESQKGFTLAQKMVGRACGVDGIRPGQYCEPRMTSVGSQDTT
GPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVVTHHTLPDFIMNRGGVSLRPGDG
VIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFK
GEMQPGITLRDLVHAIPYYAIKQGLLTVEKKGKKNIFSGRILEIEGLENLKVEQAFELSD
ASAERSAAACTIKLAKEPIIEYLNSNIVLLKYMIAEGYGDARTLERRIKGMEQWLADPQL
MEADPDAEYAAVIEIDLAEIKEPILCAPNDPDDARLLSEVQGDKIDEVFIGSCMTNIGHF
RAAGKLLAKFKGMIPTRLWIAPPTKMDAALLSEEGYYSIYGKSGARIEIPGCSLCMGNQA
RVADNATVVSTSTRNFPNRLGQGANVYLASAELAAVSAILGKLPTSEEYLTFAADLQQDK
DDTYRYMNFDQINSYTKKADNVIFQSAV
Download sequence
Identical sequences Q9CP54
WP_010906525.1.12311 WP_010906525.1.15732 WP_010906525.1.19996 WP_010906525.1.40210 WP_010906525.1.45422 WP_010906525.1.4808 WP_010906525.1.53852 WP_010906525.1.6219 WP_010906525.1.62389 WP_010906525.1.66990 WP_010906525.1.8281 WP_010906525.1.89773 WP_010906525.1.9746 WP_010906525.1.9947 272843.PM0204 gi|15602069|ref|NP_245141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]