SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602074|ref|NP_245146.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602074|ref|NP_245146.1|
Domain Number 1 Region: 10-89
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 2.43e-18
Family Sigma2 domain of RNA polymerase sigma factors 0.0019
Further Details:      
 
Domain Number 2 Region: 96-177
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000118
Family Sigma4 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602074|ref|NP_245146.1|
Sequence length 183
Comment RNA polymerase sigma factor [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MHNISSEELETIRGQMLKFATLQLKDPILAEDVVQEAFVSALKNIESFKRQSALKTWIFA
ILKNKIIDYLRVNHRFVVESELITDEDENSFFDGGRWRKEYAPSRLQENENTVYSEQFWV
LFEVCLTRLPALQAKVFMMREYLELTSEDICSTEQITTSNLHVLLYRARLQLQHCLTTKM
GER
Download sequence
Identical sequences A0A1E3XM59 Q9CP51
gi|378774721|ref|YP_005176964.1| gi|15602074|ref|NP_245146.1| 272843.PM0209 WP_005720711.1.10027 WP_005720711.1.10721 WP_005720711.1.11014 WP_005720711.1.11214 WP_005720711.1.11947 WP_005720711.1.12156 WP_005720711.1.12311 WP_005720711.1.1307 WP_005720711.1.14908 WP_005720711.1.15732 WP_005720711.1.17217 WP_005720711.1.17980 WP_005720711.1.18123 WP_005720711.1.19996 WP_005720711.1.20287 WP_005720711.1.21657 WP_005720711.1.22153 WP_005720711.1.2313 WP_005720711.1.24757 WP_005720711.1.26616 WP_005720711.1.26777 WP_005720711.1.27416 WP_005720711.1.27592 WP_005720711.1.28084 WP_005720711.1.29697 WP_005720711.1.30617 WP_005720711.1.34253 WP_005720711.1.35562 WP_005720711.1.35978 WP_005720711.1.36022 WP_005720711.1.3807 WP_005720711.1.38246 WP_005720711.1.3839 WP_005720711.1.39152 WP_005720711.1.3957 WP_005720711.1.40210 WP_005720711.1.40787 WP_005720711.1.41462 WP_005720711.1.41657 WP_005720711.1.42469 WP_005720711.1.42512 WP_005720711.1.42943 WP_005720711.1.43687 WP_005720711.1.44741 WP_005720711.1.45422 WP_005720711.1.47685 WP_005720711.1.4808 WP_005720711.1.49053 WP_005720711.1.50853 WP_005720711.1.51342 WP_005720711.1.52066 WP_005720711.1.52585 WP_005720711.1.52859 WP_005720711.1.53852 WP_005720711.1.55074 WP_005720711.1.55401 WP_005720711.1.57420 WP_005720711.1.58111 WP_005720711.1.58257 WP_005720711.1.58450 WP_005720711.1.58628 WP_005720711.1.58910 WP_005720711.1.59455 WP_005720711.1.60478 WP_005720711.1.60664 WP_005720711.1.61098 WP_005720711.1.61860 WP_005720711.1.62016 WP_005720711.1.6219 WP_005720711.1.62389 WP_005720711.1.6332 WP_005720711.1.63549 WP_005720711.1.65482 WP_005720711.1.65878 WP_005720711.1.66934 WP_005720711.1.66990 WP_005720711.1.72215 WP_005720711.1.73917 WP_005720711.1.74955 WP_005720711.1.75804 WP_005720711.1.78987 WP_005720711.1.79347 WP_005720711.1.79593 WP_005720711.1.80223 WP_005720711.1.80589 WP_005720711.1.80911 WP_005720711.1.81885 WP_005720711.1.83579 WP_005720711.1.86541 WP_005720711.1.87897 WP_005720711.1.89773 WP_005720711.1.90081 WP_005720711.1.90179 WP_005720711.1.90578 WP_005720711.1.91495 WP_005720711.1.94432 WP_005720711.1.94435 WP_005720711.1.95718 WP_005720711.1.9746 WP_005720711.1.9947 gi|386834684|ref|YP_006240001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]