SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602084|ref|NP_245156.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602084|ref|NP_245156.1|
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily CheY-like 1.39e-35
Family CheY-related 0.00000548
Further Details:      
 
Domain Number 2 Region: 136-232
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 6.24e-23
Family PhoB-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602084|ref|NP_245156.1|
Sequence length 236
Comment two-component response regulator [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MGTPQILIVEDEAITRNTLKSIFEAEGYEVFEAADGAQMHRILSNKVINLVIMDINLPGK
NGLMLARELRETTNTALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLQR
TMQENSKDSHHPIEQYRFNGWTLDLNSRTLINPEGEEYKLPRSEFRAMLHFCENPGKIQT
REELLKKMTGRELKPQDRTVDVTIRRIRKHFEDHPETPEIIATIHGEGYRFCGELE
Download sequence
Identical sequences A0A140D7M3 A0A2K2YYS5 Q9CP42 V4NFC4
gi|386834672|ref|YP_006239989.1| gi|383310681|ref|YP_005363491.1| gi|15602084|ref|NP_245156.1| 272843.PM0219 WP_005723609.1.12311 WP_005723609.1.15732 WP_005723609.1.19996 WP_005723609.1.23830 WP_005723609.1.24757 WP_005723609.1.26777 WP_005723609.1.27416 WP_005723609.1.27592 WP_005723609.1.27664 WP_005723609.1.40210 WP_005723609.1.40787 WP_005723609.1.41297 WP_005723609.1.41351 WP_005723609.1.41657 WP_005723609.1.41667 WP_005723609.1.4211 WP_005723609.1.42512 WP_005723609.1.45422 WP_005723609.1.4808 WP_005723609.1.53852 WP_005723609.1.58111 WP_005723609.1.6219 WP_005723609.1.62389 WP_005723609.1.66990 WP_005723609.1.70689 WP_005723609.1.74955 WP_005723609.1.75804 WP_005723609.1.81885 WP_005723609.1.8281 WP_005723609.1.88402 WP_005723609.1.89773 WP_005723609.1.92478 WP_005723609.1.93940 WP_005723609.1.94432 WP_005723609.1.9746 WP_005723609.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]