SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602097|ref|NP_245169.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602097|ref|NP_245169.1|
Domain Number 1 Region: 1-353
Classification Level Classification E-value
Superfamily QueA-like 1.7e-136
Family QueA-like 0.0000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602097|ref|NP_245169.1|
Sequence length 363
Comment S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRVSDFYFDLPDELIARYPKPDRTASRLLQLNGENGEITHRTFADILDQIHEGDLLIFNN
TRVIPARMFGRKASGGKVEVLVERILSDTRFLAHVRSSKAPKEGAELWLGEDKLGEHHGV
KMIMVARHDTLFELEIAQKQTALLDVLQQIGHMPLPPYIDRPDEEADKERYQTVYNKVPG
AVAAPTAGLHFDDALLAQLKAKGVNFAFVTLHVGAGTFQPVRVEQIEDHKMHAEYVEVPQ
EVCDAIIATKQAGKRVIAVGTTSVRSVESAALATEEKGEHALITPYFSDTSIFIYPGKTF
RVVDCLITNFHLPESTLIMLVSAFAGYRHTMQAYQSAVENRYRFFSYGDAMFISKNPHVN
GLD
Download sequence
Identical sequences P57832
272843.PM0232 gi|15602097|ref|NP_245169.1| WP_010906536.1.12311 WP_010906536.1.15732 WP_010906536.1.19996 WP_010906536.1.26777 WP_010906536.1.40210 WP_010906536.1.41351 WP_010906536.1.41667 WP_010906536.1.45422 WP_010906536.1.4808 WP_010906536.1.53852 WP_010906536.1.58111 WP_010906536.1.6219 WP_010906536.1.62389 WP_010906536.1.66990 WP_010906536.1.81885 WP_010906536.1.8281 WP_010906536.1.88402 WP_010906536.1.89773 WP_010906536.1.92478 WP_010906536.1.93940 WP_010906536.1.9746 WP_010906536.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]