SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602101|ref|NP_245173.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602101|ref|NP_245173.1|
Domain Number 1 Region: 25-529
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.62e-163
Family Phosphate binding protein-like 0.00000000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602101|ref|NP_245173.1|
Sequence length 532
Comment hypothetical protein PM0236 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLTKLSLAVLAMTSTAAFAAAPKTFVYCSEASPSYLSPVLGTDGATIDASGQAMFNGL
TTFERGTTNVIPALAEKWDVSEDGKTYVFHLRKGVKFHSNKDFKPTRDFNADDVVFSFNR
QLDPNHPYHKVSGGSYEYFIGMDMQNIIDKVEKVDDYTVKISLKVPNAPFLANLAMDFAS
IYSAQYADAMAKAKTPEKLDSAPIGTGPFEFVSYQKDSAVRYKAFENYWQGKAKIDRLVF
SITPDASVRYAKLQKGECHAAPYPNPADIAKLKADSNITLLTKPGLNVGYLNFNVQKAPF
DNVKVRQALNYAVNKDAIIESVYQGAGQVAKNPIPPTMWSYNDEVKDYAYDPEKAKALLK
EAGFENGFETDLWAMPVSRPYNPNARRMAELVQADWEKVGVKAKIVSYEWGEYLKRMRAG
DHQTGMMGWTGDNGDPDNFLNTLLSCAAVESGSNYANFCHKEFNDLVTKAAQVTDPAERT
ALYQQAQLVFKEQAPWITIAHSTTYFPVRKEVKGYVIDPFGLHNFYAVELEK
Download sequence
Identical sequences A0A1D7R2M4 Q9CP30 V4N9W5
WP_010906537.1.10027 WP_010906537.1.10721 WP_010906537.1.12311 WP_010906537.1.15732 WP_010906537.1.17217 WP_010906537.1.17980 WP_010906537.1.18123 WP_010906537.1.19996 WP_010906537.1.20287 WP_010906537.1.22153 WP_010906537.1.2313 WP_010906537.1.23830 WP_010906537.1.26616 WP_010906537.1.26777 WP_010906537.1.27416 WP_010906537.1.27592 WP_010906537.1.29697 WP_010906537.1.30617 WP_010906537.1.34253 WP_010906537.1.35978 WP_010906537.1.39152 WP_010906537.1.40210 WP_010906537.1.41462 WP_010906537.1.42512 WP_010906537.1.42943 WP_010906537.1.44741 WP_010906537.1.45422 WP_010906537.1.47685 WP_010906537.1.4808 WP_010906537.1.49053 WP_010906537.1.52066 WP_010906537.1.53852 WP_010906537.1.57420 WP_010906537.1.58450 WP_010906537.1.58910 WP_010906537.1.59455 WP_010906537.1.60664 WP_010906537.1.61860 WP_010906537.1.62016 WP_010906537.1.6219 WP_010906537.1.62389 WP_010906537.1.65482 WP_010906537.1.65878 WP_010906537.1.66934 WP_010906537.1.66990 WP_010906537.1.73917 WP_010906537.1.75804 WP_010906537.1.79593 WP_010906537.1.80223 WP_010906537.1.80589 WP_010906537.1.81885 WP_010906537.1.8281 WP_010906537.1.87897 WP_010906537.1.89773 WP_010906537.1.90081 WP_010906537.1.90179 WP_010906537.1.91495 WP_010906537.1.94432 WP_010906537.1.94435 WP_010906537.1.9746 WP_010906537.1.9947 272843.PM0236 gi|378774689|ref|YP_005176932.1| gi|15602101|ref|NP_245173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]