SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602110|ref|NP_245182.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602110|ref|NP_245182.1|
Domain Number 1 Region: 17-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.16e-46
Family GHMP Kinase, N-terminal domain 0.00000189
Further Details:      
 
Domain Number 2 Region: 174-290
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.58e-39
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602110|ref|NP_245182.1|
Sequence length 295
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQHYHFSHSLLAQQEKPYRFPCPAKLNLFLYINGKRQDGYHELQTLFQFVDFGDWLDIEV
REDNEICLTPELPSLKNEDNLVYRAAKLLQQKTNCALGANLTLDKILPMGSGLGGGSSNA
ATALVALNYLWNTQLSTKQLAKLGLMLGADVPIFVHGHAAFAEGVGEKITYCEPKEKWYV
VLKPNVSISTATVFSDPDLIRNTPKQSLEQLLNQKYANDCEKVVLNHYPEVEEILHRLLQ
YAPSRLTGTGACVFAEFNDEESAQLAFQTIPKNYFGFVAQGLNKSPLHNMLAKIS
Download sequence
Identical sequences A0A1E3XL27 P57833
272843.PM0245 WP_005724298.1.11014 WP_005724298.1.11214 WP_005724298.1.11947 WP_005724298.1.12156 WP_005724298.1.12311 WP_005724298.1.14908 WP_005724298.1.15732 WP_005724298.1.17980 WP_005724298.1.19996 WP_005724298.1.21657 WP_005724298.1.24757 WP_005724298.1.27592 WP_005724298.1.28084 WP_005724298.1.35562 WP_005724298.1.36022 WP_005724298.1.3807 WP_005724298.1.38246 WP_005724298.1.3839 WP_005724298.1.3957 WP_005724298.1.40210 WP_005724298.1.40787 WP_005724298.1.41297 WP_005724298.1.41351 WP_005724298.1.41657 WP_005724298.1.41667 WP_005724298.1.42469 WP_005724298.1.42512 WP_005724298.1.43687 WP_005724298.1.45422 WP_005724298.1.4808 WP_005724298.1.49053 WP_005724298.1.51342 WP_005724298.1.52585 WP_005724298.1.52859 WP_005724298.1.53852 WP_005724298.1.55074 WP_005724298.1.55401 WP_005724298.1.57956 WP_005724298.1.58111 WP_005724298.1.58257 WP_005724298.1.60478 WP_005724298.1.61098 WP_005724298.1.6219 WP_005724298.1.62389 WP_005724298.1.6332 WP_005724298.1.63549 WP_005724298.1.66990 WP_005724298.1.70689 WP_005724298.1.72215 WP_005724298.1.78987 WP_005724298.1.79347 WP_005724298.1.79593 WP_005724298.1.81885 WP_005724298.1.8281 WP_005724298.1.83579 WP_005724298.1.88402 WP_005724298.1.89773 WP_005724298.1.90578 WP_005724298.1.92478 WP_005724298.1.93940 WP_005724298.1.94432 WP_005724298.1.95718 WP_005724298.1.9746 WP_005724298.1.9947 gi|383310651|ref|YP_005363461.1| gi|386834644|ref|YP_006239961.1| gi|15602110|ref|NP_245182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]