SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602117|ref|NP_245189.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602117|ref|NP_245189.1|
Domain Number 1 Region: 71-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.31e-49
Family RecA protein-like (ATPase-domain) 0.0092
Further Details:      
 
Domain Number 2 Region: 257-271,305-457
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-43
Family ATP-dependent protease Lon (La), catalytic domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602117|ref|NP_245189.1|
Sequence length 459
Comment DNA repair protein RadA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAKAPKTAYVCNDCGAEFSRWQGQCAACKAWNTISEVRLVSSSNSAKGDRFSGYAGETRA
KIQTLAEISLQETPRFSSGFHELDRVLGGGVVPGSAILIGGHPGAGKSTLLLQVMCGLAQ
NMTALYVTGEESLQQVAMRAKRLGLPTDKLNMLSETSVEQICQLADQLKPQIIVIDSIQV
MHLADIQSSPGSVAQVRECASFLTRYAKTRQVAIIMVGHVTKDGTLAGPKVLEHCIDCSI
LLEGEADSRYRTLRSHKNRFGAVNELGVFGMTEQGLREVKNPSAIFLSRGEEQTPGSSVM
VIWEGTRPLLVEIQALVDHSMLANPRRVAVGLEQNRLALLLAVLHRHGGLQMSDQDVFVN
VVGGVKVTETSADLALLLALISSFRNRPLPQDLVVFGEVGLAGEIRPVPSGQERIGEAAK
HGFKRAIVPFANRPKSAVPNMDVFTVKKLSDALAILENF
Download sequence
Identical sequences A0A1D2NS72 A0A2K2YYK6 Q9CP16
gi|386834637|ref|YP_006239954.1| 272843.PM0252 gi|15602117|ref|NP_245189.1| gi|383310644|ref|YP_005363454.1| WP_005724307.1.11014 WP_005724307.1.11214 WP_005724307.1.11947 WP_005724307.1.12156 WP_005724307.1.12311 WP_005724307.1.15732 WP_005724307.1.17980 WP_005724307.1.19996 WP_005724307.1.21657 WP_005724307.1.26777 WP_005724307.1.27592 WP_005724307.1.27664 WP_005724307.1.28084 WP_005724307.1.35562 WP_005724307.1.36022 WP_005724307.1.3807 WP_005724307.1.38246 WP_005724307.1.3839 WP_005724307.1.40210 WP_005724307.1.41297 WP_005724307.1.41351 WP_005724307.1.41657 WP_005724307.1.41667 WP_005724307.1.42469 WP_005724307.1.42512 WP_005724307.1.43687 WP_005724307.1.45422 WP_005724307.1.4808 WP_005724307.1.49053 WP_005724307.1.51342 WP_005724307.1.52585 WP_005724307.1.52859 WP_005724307.1.53852 WP_005724307.1.55074 WP_005724307.1.55401 WP_005724307.1.58111 WP_005724307.1.58257 WP_005724307.1.60478 WP_005724307.1.6219 WP_005724307.1.62389 WP_005724307.1.6332 WP_005724307.1.63549 WP_005724307.1.66990 WP_005724307.1.70689 WP_005724307.1.72215 WP_005724307.1.78987 WP_005724307.1.79347 WP_005724307.1.79593 WP_005724307.1.81885 WP_005724307.1.8281 WP_005724307.1.83579 WP_005724307.1.88402 WP_005724307.1.89773 WP_005724307.1.90578 WP_005724307.1.92478 WP_005724307.1.93940 WP_005724307.1.94432 WP_005724307.1.95718 WP_005724307.1.9746 WP_005724307.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]