SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602123|ref|NP_245195.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602123|ref|NP_245195.1|
Domain Number 1 Region: 117-423
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-98
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000947
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 9.94e-28
Family Seryl-tRNA synthetase (SerRS) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602123|ref|NP_245195.1|
Sequence length 428
Comment seryl-tRNA synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIDPNLLRNNLEEVAEKLKVKRNFVLDVALLSELEEQRKSLQVKTESLQAERNARSKNIG
QAKARGEDISALLNEVEHMGIELSTTKAHLDEVLAEINQIVLAIPNLPADEVPLGKDESE
NLEVFRWGTPKTFDFDVKDHVSLGEGLKGLDFAAGVKLSGSRFVVMKGQIAKLHRALSQF
MLDLHTEQHGYTETYVPYLVNHATLYGTGQLPKFGEDLFHTNALEGEQPYALIPTAEVPV
TNLVRDEILDEADLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVAPETSM
QVLEELTGQAEKVLQLLELPYRKVLLCTGDMGFGSCKTYDLEVWLPAQNTYREISSCSNM
WDFQARRMQARCRSKTDKKTRLVHTLNGSGLAVGRTLVAILENYQNADGTITVPSVLRPY
MGGLAQIG
Download sequence
Identical sequences A0A1D2NS89 A0A2K2YZR0 P57836
WP_005751192.1.11214 WP_005751192.1.11947 WP_005751192.1.12156 WP_005751192.1.12311 WP_005751192.1.15732 WP_005751192.1.19996 WP_005751192.1.26777 WP_005751192.1.27664 WP_005751192.1.28084 WP_005751192.1.35562 WP_005751192.1.3807 WP_005751192.1.38246 WP_005751192.1.3839 WP_005751192.1.40210 WP_005751192.1.43687 WP_005751192.1.45422 WP_005751192.1.4808 WP_005751192.1.49053 WP_005751192.1.52585 WP_005751192.1.52859 WP_005751192.1.53852 WP_005751192.1.55401 WP_005751192.1.58257 WP_005751192.1.60478 WP_005751192.1.6219 WP_005751192.1.62389 WP_005751192.1.6332 WP_005751192.1.63549 WP_005751192.1.66990 WP_005751192.1.72215 WP_005751192.1.78987 WP_005751192.1.79347 WP_005751192.1.81885 WP_005751192.1.8281 WP_005751192.1.83579 WP_005751192.1.89773 WP_005751192.1.9746 WP_005751192.1.9947 272843.PM0258 gi|15602123|ref|NP_245195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]