SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602125|ref|NP_245197.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602125|ref|NP_245197.1|
Domain Number 1 Region: 26-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.57e-88
Family Phosphate binding protein-like 0.0000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602125|ref|NP_245197.1|
Sequence length 348
Comment protein PotD [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLTGILTASVMMLGVSNYASAANNEVYLYTWTEYVPEGLLDEFTKQTGIKVIVSSLES
NETMYAKLKTLGKDGGYDVIAPTSYFVSKMAREGMLKELDHSKLPVIKELDPNMLDRPYD
KGNKYSLPQLFGATGIAYNTTNQDPSHFQSWGDLWNAEFKGKVQMLDDPRELFNIALLKM
GKDPNTQDPAVLKEAYEELLKLRPNILSFNSDNPASTFISGETDIGLLWNGSIRIAKNEG
ATVEMIYPKEGTMLWIDNLAIPSNAKNTENAYKLINYLLSTDVSEKLTLNIGYPTSNLEA
LKRLPKELTDDHATFLTQEVIDRSQWQVDVDNAIDLYEGYYQKLKAAK
Download sequence
Identical sequences Q9CP10
272843.PM0260 WP_010906549.1.12311 WP_010906549.1.15732 WP_010906549.1.19996 WP_010906549.1.40210 WP_010906549.1.45422 WP_010906549.1.4808 WP_010906549.1.53852 WP_010906549.1.6219 WP_010906549.1.62389 WP_010906549.1.66990 WP_010906549.1.81885 WP_010906549.1.8281 WP_010906549.1.89773 WP_010906549.1.9746 WP_010906549.1.9947 gi|15602125|ref|NP_245197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]