SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602126|ref|NP_245198.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602126|ref|NP_245198.1|
Domain Number 1 Region: 36-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.62e-90
Family Phosphate binding protein-like 0.00000000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602126|ref|NP_245198.1|
Sequence length 358
Comment protein PotD [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MITLNRRMIEMKKFAGLVTAGIMTFGLAANAHATNDTVYLYTWTEYVPDGLLDDFTKETG
IKVIVSSLESNETMYAKLKTQGETSGYDVIAPSNYFVSKMAREGMLKELDHSKLPVIKDL
NPDWLDKPYDKGNKYSLPQLLGAPGIAFNTDSYKGENFTAWGDLWKPEFKGKVQLLDDAR
EVFNIALLKLGQDPNTTDPAIIKQAYEELLKLRPNVLSFNSDNPANSFISGEVEVGQLWN
GSVRIAKKEQAPLNMVFPKEGPVLWVDTLAIPANSKNPDGAHKLINYLLSAKVAAQLAEE
IGYPTSNLKALELLPSEVTQDPAVYPTAEILQNSHWQDDVGDAVELYENYYQQLKAAK
Download sequence
Identical sequences Q9CP09
272843.PM0261 gi|15602126|ref|NP_245198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]