SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602146|ref|NP_245218.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602146|ref|NP_245218.1|
Domain Number 1 Region: 123-288
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 2.88e-56
Family Succinyl-CoA synthetase domains 0.0000000615
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.1e-43
Family CoA-binding domain 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602146|ref|NP_245218.1|
Sequence length 289
Comment hypothetical protein PM0281 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSILINKDTKVICQGFTGGQGTFHSEQALAYGTQLVGGVSPGKGGTTHLGLPVFNTVRDA
VDATGATASVIYVPAPGCKDAILEAIDAGIQLVICITEGIPTLDMLQVKQRLNQTGVRMI
GPNCPGVITPEECKIGIMPGNIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTCVGIGG
DPIPGSNFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAAAFIKDYVTKPVVSYIAGVTAP
KGKRMGHAGAIISGGKGTADEKFAALEAAGVKTVRSLAEIGAALKALLK
Download sequence
Identical sequences A0A1D2NS36 A0A2K2YYL7 Q9CNY9
gi|15602146|ref|NP_245218.1| WP_005751207.1.11014 WP_005751207.1.11214 WP_005751207.1.11947 WP_005751207.1.12156 WP_005751207.1.12311 WP_005751207.1.14908 WP_005751207.1.15732 WP_005751207.1.17980 WP_005751207.1.19996 WP_005751207.1.21657 WP_005751207.1.24757 WP_005751207.1.26777 WP_005751207.1.27664 WP_005751207.1.28084 WP_005751207.1.35562 WP_005751207.1.3807 WP_005751207.1.38246 WP_005751207.1.3839 WP_005751207.1.3957 WP_005751207.1.40210 WP_005751207.1.40787 WP_005751207.1.41297 WP_005751207.1.42469 WP_005751207.1.43687 WP_005751207.1.45422 WP_005751207.1.4808 WP_005751207.1.49053 WP_005751207.1.51342 WP_005751207.1.52585 WP_005751207.1.52859 WP_005751207.1.53852 WP_005751207.1.55074 WP_005751207.1.55401 WP_005751207.1.57956 WP_005751207.1.58111 WP_005751207.1.58257 WP_005751207.1.60478 WP_005751207.1.61098 WP_005751207.1.6219 WP_005751207.1.62389 WP_005751207.1.6332 WP_005751207.1.63549 WP_005751207.1.66990 WP_005751207.1.72215 WP_005751207.1.78987 WP_005751207.1.79347 WP_005751207.1.79593 WP_005751207.1.81885 WP_005751207.1.8281 WP_005751207.1.83579 WP_005751207.1.89773 WP_005751207.1.90578 WP_005751207.1.92478 WP_005751207.1.93940 WP_005751207.1.9746 WP_005751207.1.9947 272843.PM0281 gi|383310614|ref|YP_005363424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]