SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602151|ref|NP_245223.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602151|ref|NP_245223.1|
Domain Number 1 Region: 1-337
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.27e-95
Family Tyrosine-dependent oxidoreductases 0.00000000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602151|ref|NP_245223.1|
Sequence length 338
Comment hypothetical protein PM0286 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAILVTGGAGYIGSHTVVELLNANKDVVVLDNLCNSSPKSLERVAQITGKQVKFYQGDIL
DTALLQKIFAENQIQSVIHFAGLKAVGESVQKPAEYYMNNVTGSLVLIQEMKKAGVWNFV
FSSSATVYGDPEIIPITESCKVGGTTNPYGTSKFMVEQILKDIAKATPEFSITILRYFNP
VGAHESGLIGEDPNGIPNNLLPYISQVAIGKLPQLSVFGSDYETHDGTGVRDYIHVVDLA
IGHLKALDRHEGDAGLHIYNLGTGSGYSVLDMVKAFEKVNDIKIPYKLVDRRPGDIATCY
SDPSLAKTELNWTAARGLEQMMKDTWHWQKKNPKGYRD
Download sequence
Identical sequences A0A2J9QYB7 Q9CNY5
WP_010906564.1.12311 WP_010906564.1.15732 WP_010906564.1.17980 WP_010906564.1.19996 WP_010906564.1.36022 WP_010906564.1.40210 WP_010906564.1.45422 WP_010906564.1.4808 WP_010906564.1.53852 WP_010906564.1.6219 WP_010906564.1.62389 WP_010906564.1.66990 WP_010906564.1.79593 WP_010906564.1.81885 WP_010906564.1.8281 WP_010906564.1.89773 WP_010906564.1.95718 WP_010906564.1.9746 gi|15602151|ref|NP_245223.1| 272843.PM0286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]