SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602154|ref|NP_245226.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602154|ref|NP_245226.1|
Domain Number 1 Region: 13-230
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.87e-57
Family PP-loop ATPase 0.000000771
Further Details:      
 
Domain Number 2 Region: 234-317
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 7.59e-24
Family MesJ substrate recognition domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 320-429
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.67e-21
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602154|ref|NP_245226.1|
Sequence length 431
Comment hypothetical protein PM0289 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLLTQFQAEIAQLPPTQHQFLIGFSGGLDSTALLLLFAKLREKQPHLMLRAIHIHHGLSA
NADAWVTHCQQICQQVAIPLIVEQVKIDQHKGIEAGAREARYQAIRQHLLPNEMFATAHH
QQDQTETFFLALKRGSGLAGLGAMQRKSTLYCLPICRPLLTFTRQMLLDYVKQAGCPWVE
DESNTDSRYERNFLRHEVLPRLRQRWPHFDNAVQRSAQHCFEQQQLLNELLHAEFAQHFD
KTERTFQLRDFATRSQLKQNALLRLWLAQCGLSMPSKVQLTQLIQDVILAKSDSQPQFQL
GEYCVRRYQDTLYLTPHFADLSSLRLPIHIGETLTLPDHLGTLSLQQQAGQLQVIWSHPQ
HTFTSILPLTEDPIEVRFRYSGKVRLSPTSANKDIKKLWQQHAVPVWLRQRIPLIFYADR
FKSAVGYFNAI
Download sequence
Identical sequences Q9CNY2
272843.PM0289 gi|15602154|ref|NP_245226.1| WP_010906566.1.12311 WP_010906566.1.15732 WP_010906566.1.19996 WP_010906566.1.40210 WP_010906566.1.45422 WP_010906566.1.4808 WP_010906566.1.53852 WP_010906566.1.6219 WP_010906566.1.62389 WP_010906566.1.66990 WP_010906566.1.81885 WP_010906566.1.8281 WP_010906566.1.89773 WP_010906566.1.9746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]