SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602158|ref|NP_245230.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602158|ref|NP_245230.1|
Domain Number 1 Region: 7-235
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 7.43e-57
Family Class I glutamine amidotransferases (GAT) 0.000000148
Further Details:      
 
Domain Number 2 Region: 192-444
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.35e-56
Family N-type ATP pyrophosphatases 0.0000000903
Further Details:      
 
Domain Number 3 Region: 403-523
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.23e-49
Family GMP synthetase C-terminal dimerisation domain 0.000000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602158|ref|NP_245230.1|
Sequence length 523
Comment GMP synthase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNNIHNHKILILDFGSQYTQLIARRVREIGVYCELWAWDVSEADIREFNPTGIILSGGPE
STTEENSPRAPEYVFNAGVPVLGICYGMQTMAMQLGGLTETSTHREFGYASVNLKAADAL
FAQLNDDVTSSQPKLDVWMSHGDKVTRLPDHFQVTAMTSTCPIAAMSDERRRFYGVQFHP
EVTHTKSGLELLTNFVVKICGCERNWTPENIIEDAVARLKAQVGDDEVILGLSGGVDSSV
TALLLHRAIGKNLHCVFVDNGLLRLNEAEQVMEMFGDKFGLNIIHVKAEDRFLDALKGID
EPEAKRKMIGKVFVDVFDDESKKLTSVKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVG
GLPDYMKLGLVEPLRELFKDEVRKIGLALGLPAEMLNRHPFPGPGLGVRVLGEIKKEYCD
LVRLADAIFMEELHASGWYYKVSQAFTVFLPVKSVGVMGDGRKYDWVVSLRAVETIDFMT
AHWAHLPYDLLGKISNRIINEVNGISRVVYDVSGKPPATIEWE
Download sequence
Identical sequences Q9CNX8
gi|15602158|ref|NP_245230.1| WP_010906568.1.12311 WP_010906568.1.15732 WP_010906568.1.19996 WP_010906568.1.40210 WP_010906568.1.45422 WP_010906568.1.4808 WP_010906568.1.53852 WP_010906568.1.6219 WP_010906568.1.62389 WP_010906568.1.66990 WP_010906568.1.81885 WP_010906568.1.8281 WP_010906568.1.89773 WP_010906568.1.9746 WP_010906568.1.9947 272843.PM0293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]