SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602180|ref|NP_245252.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602180|ref|NP_245252.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 6.41e-89
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602180|ref|NP_245252.1|
Sequence length 267
Comment hypothetical protein PM0315 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNPMLNIAIRAARKAGNVIAKGYERRDDLQTTLKSTNDYVTNIDKASEEAIIEVIRKSYP
DHTIITEESGALEGKDSDIQWVIDPLDGTTNFVKGLPHFSVSIAIRVKGRTEVGVVYDPI
RNELFTAVRGEGAKINDMRLRVENKRDLAGTVLTTGFPFKQTRLMPMQFAMMNNLIQDCA
DFRRMGSAALDLCYVAAGRVDGYFEVGVKAWDIAAGDLIVREAGGLVCDFNGGHSYLTSG
HLVAAAPRIVKEILNKIQPCLSDEFKK
Download sequence
Identical sequences A0A1E3XL22 A0A2K2YYZ1 Q9CNV8
gi|383309951|ref|YP_005362761.1| 272843.PM0315 gi|386834573|ref|YP_006239889.1| WP_005725868.1.12311 WP_005725868.1.14908 WP_005725868.1.15732 WP_005725868.1.17980 WP_005725868.1.19996 WP_005725868.1.21657 WP_005725868.1.24757 WP_005725868.1.26777 WP_005725868.1.27592 WP_005725868.1.27664 WP_005725868.1.36022 WP_005725868.1.3957 WP_005725868.1.40210 WP_005725868.1.40787 WP_005725868.1.41297 WP_005725868.1.41351 WP_005725868.1.41657 WP_005725868.1.41667 WP_005725868.1.4211 WP_005725868.1.42512 WP_005725868.1.45422 WP_005725868.1.4808 WP_005725868.1.51342 WP_005725868.1.53852 WP_005725868.1.55074 WP_005725868.1.57956 WP_005725868.1.58111 WP_005725868.1.61098 WP_005725868.1.6219 WP_005725868.1.62389 WP_005725868.1.66990 WP_005725868.1.70689 WP_005725868.1.79593 WP_005725868.1.81885 WP_005725868.1.8281 WP_005725868.1.88402 WP_005725868.1.89773 WP_005725868.1.92478 WP_005725868.1.93940 WP_005725868.1.94432 WP_005725868.1.95718 WP_005725868.1.9746 WP_005725868.1.9947 gi|15602180|ref|NP_245252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]