SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602208|ref|NP_245280.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602208|ref|NP_245280.1|
Domain Number 1 Region: 17-481
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 2.35e-127
Family Putative modulator of DNA gyrase, PmbA/TldD 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602208|ref|NP_245280.1|
Sequence length 482
Comment hypothetical protein PM0343 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MINTVSNTLLTPSNLTLNDLQNTFDLLSHRQIDYADLYFQLSQDENWVLEDGIIKEGGFH
IDRGVGVRAVSGEKTGFAYSDQIDLVSIQQCADAVKGIAQSKQGNRIVPQGFHQVDPILR
YQAINPLNSLSKEKKIALLYLVDKIARAEDPRVTRVSASLSAVYEEVLIVATDGTLAADI
RPLVRLSISVLVEQDGKRERGSAGAGGRFGLDWFLATERGEVRAVYFAKEAVRQALVNLS
AIAAPAGMMPVVLGAGWPGVLLHEAVGHGLEGDFNRKESSLFTGKIGELVTSPLCTIVDD
GTLQDRRGSITVDDEGVPGQYNVLIKDGILQGYMQDKMNARLMGVAPTGNGRRESYAHLP
MPRMTNTYMLAGQSQFDDLIASVDRGIFAPHFGGGQVDITSGKFVFSTSEAYLIENGKIT
KPVKGATLIGSGIEVMQNISMVADKVEIDHGVGVCGKEGQSVPVGVGQPALKIDKITVGG
TN
Download sequence
Identical sequences A0A1E3XL14 Q9CNT2
gi|15602208|ref|NP_245280.1| 272843.PM0343 WP_010906599.1.12311 WP_010906599.1.15732 WP_010906599.1.17980 WP_010906599.1.19996 WP_010906599.1.21657 WP_010906599.1.24757 WP_010906599.1.40210 WP_010906599.1.40787 WP_010906599.1.45422 WP_010906599.1.4808 WP_010906599.1.51342 WP_010906599.1.53852 WP_010906599.1.55074 WP_010906599.1.6219 WP_010906599.1.62389 WP_010906599.1.66990 WP_010906599.1.79593 WP_010906599.1.81885 WP_010906599.1.8281 WP_010906599.1.89773 WP_010906599.1.9746 WP_010906599.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]