SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602210|ref|NP_245282.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15602210|ref|NP_245282.1|
Domain Number - Region: 82-143
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000461
Family N-type ATP pyrophosphatases 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602210|ref|NP_245282.1|
Sequence length 233
Comment hypothetical protein PM0345 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTEQNIPTKKTRKGKDPHAPFVREKLSLPNGHNKLLLHSCCAPCSGEVMEAIHASGIEFT
IYFYNPNIHPLKEYLIRKEENIRFAEKWGIPFIDADYDRQEWFDRAKGMEDEPERGIRCT
MCFDMRFEKAAEYAHNNGFPVFTSCLGISRWKDMNQINGCGHRAAEKYDDVVYWDYNWRK
GGGSQRMIEISKRERFYQQEYCGCVYSLRDTNKWREANGRQKIEIGKLYYSAD
Download sequence
Identical sequences A0A1D7R0V3 Q9CNT0 V4NEQ7
272843.PM0345 gi|386834540|ref|YP_006239856.1| gi|15602210|ref|NP_245282.1| WP_010906600.1.10027 WP_010906600.1.10721 WP_010906600.1.12311 WP_010906600.1.1307 WP_010906600.1.15732 WP_010906600.1.17217 WP_010906600.1.17980 WP_010906600.1.18123 WP_010906600.1.19996 WP_010906600.1.20287 WP_010906600.1.21657 WP_010906600.1.22153 WP_010906600.1.2313 WP_010906600.1.23830 WP_010906600.1.24757 WP_010906600.1.26616 WP_010906600.1.27416 WP_010906600.1.27592 WP_010906600.1.29697 WP_010906600.1.30617 WP_010906600.1.34253 WP_010906600.1.35978 WP_010906600.1.36022 WP_010906600.1.39152 WP_010906600.1.40210 WP_010906600.1.40787 WP_010906600.1.41351 WP_010906600.1.41462 WP_010906600.1.41657 WP_010906600.1.41667 WP_010906600.1.4211 WP_010906600.1.42512 WP_010906600.1.42943 WP_010906600.1.44741 WP_010906600.1.45422 WP_010906600.1.47685 WP_010906600.1.4808 WP_010906600.1.50853 WP_010906600.1.51342 WP_010906600.1.52066 WP_010906600.1.53852 WP_010906600.1.57420 WP_010906600.1.58111 WP_010906600.1.58450 WP_010906600.1.58628 WP_010906600.1.58910 WP_010906600.1.59455 WP_010906600.1.60664 WP_010906600.1.61860 WP_010906600.1.62016 WP_010906600.1.6219 WP_010906600.1.62389 WP_010906600.1.65482 WP_010906600.1.65878 WP_010906600.1.66934 WP_010906600.1.66990 WP_010906600.1.73917 WP_010906600.1.74955 WP_010906600.1.75804 WP_010906600.1.79593 WP_010906600.1.80223 WP_010906600.1.80589 WP_010906600.1.80911 WP_010906600.1.81885 WP_010906600.1.86541 WP_010906600.1.87897 WP_010906600.1.88402 WP_010906600.1.89773 WP_010906600.1.90081 WP_010906600.1.90179 WP_010906600.1.91495 WP_010906600.1.92478 WP_010906600.1.93940 WP_010906600.1.94432 WP_010906600.1.94435 WP_010906600.1.95718 WP_010906600.1.9746 WP_010906600.1.9947 gi|378774062|ref|YP_005176305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]