SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602231|ref|NP_245303.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602231|ref|NP_245303.1|
Domain Number 1 Region: 7-116
Classification Level Classification E-value
Superfamily YjgF-like 1.57e-26
Family YjgF/L-PSP 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602231|ref|NP_245303.1|
Sequence length 117
Comment hypothetical protein PM0366 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MGKVHRFHSNGRLSEIAIYNGIIHLAGQVPEKTTTETAYEQTKEVLGLIDQLLSEAGSKK
AQIIHAQIYLADMDYYDEMNKAWDEWVDKENPPTRATVEARLAHPDWKVEIVLTAAA
Download sequence
Identical sequences A0A1E3XKU6 A0A2K2YYW6 Q9CNR1 V4PY16
gi|15602231|ref|NP_245303.1| gi|386834519|ref|YP_006239835.1| gi|378774083|ref|YP_005176326.1| WP_005721544.1.10027 WP_005721544.1.10721 WP_005721544.1.11014 WP_005721544.1.11214 WP_005721544.1.11947 WP_005721544.1.12156 WP_005721544.1.12311 WP_005721544.1.1307 WP_005721544.1.14908 WP_005721544.1.15732 WP_005721544.1.17217 WP_005721544.1.17980 WP_005721544.1.18123 WP_005721544.1.19996 WP_005721544.1.20287 WP_005721544.1.21657 WP_005721544.1.22153 WP_005721544.1.2313 WP_005721544.1.23830 WP_005721544.1.24757 WP_005721544.1.26616 WP_005721544.1.26777 WP_005721544.1.27416 WP_005721544.1.27592 WP_005721544.1.27664 WP_005721544.1.28084 WP_005721544.1.29697 WP_005721544.1.30617 WP_005721544.1.34253 WP_005721544.1.35562 WP_005721544.1.35978 WP_005721544.1.36022 WP_005721544.1.3807 WP_005721544.1.38246 WP_005721544.1.3839 WP_005721544.1.39152 WP_005721544.1.3957 WP_005721544.1.40210 WP_005721544.1.40787 WP_005721544.1.41297 WP_005721544.1.41351 WP_005721544.1.41462 WP_005721544.1.41657 WP_005721544.1.41667 WP_005721544.1.4211 WP_005721544.1.42469 WP_005721544.1.42512 WP_005721544.1.42943 WP_005721544.1.43687 WP_005721544.1.44741 WP_005721544.1.45422 WP_005721544.1.47685 WP_005721544.1.4808 WP_005721544.1.49053 WP_005721544.1.50853 WP_005721544.1.51342 WP_005721544.1.52066 WP_005721544.1.52585 WP_005721544.1.52859 WP_005721544.1.53852 WP_005721544.1.55074 WP_005721544.1.55401 WP_005721544.1.57420 WP_005721544.1.57956 WP_005721544.1.58111 WP_005721544.1.58257 WP_005721544.1.58450 WP_005721544.1.58628 WP_005721544.1.58910 WP_005721544.1.59455 WP_005721544.1.60478 WP_005721544.1.60664 WP_005721544.1.61098 WP_005721544.1.61860 WP_005721544.1.62016 WP_005721544.1.6219 WP_005721544.1.62389 WP_005721544.1.6332 WP_005721544.1.63549 WP_005721544.1.65482 WP_005721544.1.65878 WP_005721544.1.66934 WP_005721544.1.66990 WP_005721544.1.72215 WP_005721544.1.73917 WP_005721544.1.74955 WP_005721544.1.75804 WP_005721544.1.78987 WP_005721544.1.79347 WP_005721544.1.79593 WP_005721544.1.80223 WP_005721544.1.80589 WP_005721544.1.80911 WP_005721544.1.81885 WP_005721544.1.8281 WP_005721544.1.83579 WP_005721544.1.86541 WP_005721544.1.87897 WP_005721544.1.88402 WP_005721544.1.89773 WP_005721544.1.90081 WP_005721544.1.90179 WP_005721544.1.90578 WP_005721544.1.91495 WP_005721544.1.92478 WP_005721544.1.93940 WP_005721544.1.94432 WP_005721544.1.94435 WP_005721544.1.95718 WP_005721544.1.9746 WP_005721544.1.9947 gi|383310001|ref|YP_005362811.1| 272843.PM0366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]