SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602235|ref|NP_245307.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602235|ref|NP_245307.1|
Domain Number 1 Region: 388-623
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 9.42e-79
Family Type II DNA topoisomerase 0.00018
Further Details:      
 
Domain Number 2 Region: 5-215
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.07e-66
Family DNA gyrase/MutL, N-terminal domain 0.0000000471
Further Details:      
 
Domain Number 3 Region: 217-382
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-46
Family DNA gyrase/MutL, second domain 0.0000000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602235|ref|NP_245307.1|
Sequence length 632
Comment DNA topoisomerase IV subunit B [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTSNYSAQEITVLKDLEPVQLRPGMYTDTTRPNHLGQEVIDNSVDEALAGYANKIEVVLH
KDQSLEVIDNGRGMPVDIHPVEKLSGVEVILTKLHAGGKFSNKNYEFSGGLHGVGISVVN
ALSERVDVTVKRNGEVYKIAFENGRKVEELEVIGTCGRRNTGTTVHFKPNPKYFDSDKFS
VSRLRHLLRAKAVLCSGLEIKFIDKINQTEDCWCYEDGLADYLSEAVNGLETLPETPFIG
DFKGDTEAVSWALLWLPEGGDLLSESYVNLIPTIQGGTHVNGLRQGLLDAMREFCEFRNL
LPRGVKLSADDIWERCAYVLSLKMQDPQFAGQTKERLSSRQSAVFVAGVVKDAFSLWLNQ
HVQQAELLAEMAISSAQRRLRAAKKVVRKKLVSGPALPGKLADCSQQDLDKTELFLVEGD
SAGGSAKQARDREYQAILPLRGKILNTWEVSSEQVLSSSEIHDIAVALGIDPDNEDLSQL
RYGKVCILADADSDGLHIATLLCALFLRHFPKLVQKGHVYVAMPPLYRIDLGKDVFYALD
ESEKDAILDRLKGKKGKPNVQRFKGLGEMNPLQLRETTMDPNTRRLVQLTYALEQEEQAA
TLELMDMLLAKKRAEDRKNWLQTKGDQVDLAV
Download sequence
Identical sequences Q9CNQ7
gi|15602235|ref|NP_245307.1| WP_010906610.1.12311 WP_010906610.1.15732 WP_010906610.1.19996 WP_010906610.1.40210 WP_010906610.1.45422 WP_010906610.1.4808 WP_010906610.1.6219 WP_010906610.1.62389 WP_010906610.1.66990 WP_010906610.1.81885 WP_010906610.1.8281 WP_010906610.1.89773 WP_010906610.1.9746 WP_010906610.1.9947 272843.PM0370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]