SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602237|ref|NP_245309.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602237|ref|NP_245309.1|
Domain Number 1 Region: 1-202
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.73e-17
Family Aminoacid dehydrogenase-like, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602237|ref|NP_245309.1|
Sequence length 412
Comment hypothetical protein PM0372 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKNVLVIGAGGVSQVVVHKCAQHNDVLGKISIASRKIEKCRAIADSVAEKGNFKVPATI
DCFEIDVFDIEATKALIQKTESQIVINVGPSFVNMSVLQACIETGAAYIDTAMHEDPSKV
CETPPWYANYEWKRRELCKQNNITAILSAGFDPGVVNAYAAYAVNDEFDSVESIDIIDIN
AGSHGRYFATNFDPEVNFREFTGTVWSWQNSQWVSNKMFEIKRTDDLPIVGMQNSYLTGH
EELHSLSTHLNVPNIRFWMGFGDHYINVFNVLKNLGLLSVHPVKTAEGVEVIPIKVVKAV
LPDPASLAPNYTGKTCIGNLVKGKKDGKDKEIFIYNVADHKEAYEEVGSQGISYTAGVPA
VAAALLIATGEWDVGEMRNVEQLDPKPFLNLLNKIGLPNRIKDEHGDRELAF
Download sequence
Identical sequences A0A1D7R0Z2 A0A2K2YZ87 Q9CNQ5 V4MQZ3
272843.PM0372 gi|383310007|ref|YP_005362817.1| gi|15602237|ref|NP_245309.1| gi|378774089|ref|YP_005176332.1| WP_005751285.1.10027 WP_005751285.1.10721 WP_005751285.1.11014 WP_005751285.1.11214 WP_005751285.1.11947 WP_005751285.1.12156 WP_005751285.1.12311 WP_005751285.1.1307 WP_005751285.1.14908 WP_005751285.1.15732 WP_005751285.1.17217 WP_005751285.1.17980 WP_005751285.1.18123 WP_005751285.1.19996 WP_005751285.1.20287 WP_005751285.1.21657 WP_005751285.1.22153 WP_005751285.1.2313 WP_005751285.1.23830 WP_005751285.1.24757 WP_005751285.1.26616 WP_005751285.1.26777 WP_005751285.1.27416 WP_005751285.1.27592 WP_005751285.1.27664 WP_005751285.1.28084 WP_005751285.1.29697 WP_005751285.1.30617 WP_005751285.1.34253 WP_005751285.1.35562 WP_005751285.1.35978 WP_005751285.1.36022 WP_005751285.1.3807 WP_005751285.1.38246 WP_005751285.1.3839 WP_005751285.1.39152 WP_005751285.1.3957 WP_005751285.1.40210 WP_005751285.1.41297 WP_005751285.1.41351 WP_005751285.1.41462 WP_005751285.1.41657 WP_005751285.1.41667 WP_005751285.1.42469 WP_005751285.1.42512 WP_005751285.1.42943 WP_005751285.1.43687 WP_005751285.1.44741 WP_005751285.1.45422 WP_005751285.1.47685 WP_005751285.1.4808 WP_005751285.1.49053 WP_005751285.1.50853 WP_005751285.1.51342 WP_005751285.1.52066 WP_005751285.1.52585 WP_005751285.1.52859 WP_005751285.1.53852 WP_005751285.1.55401 WP_005751285.1.57420 WP_005751285.1.57956 WP_005751285.1.58111 WP_005751285.1.58257 WP_005751285.1.58450 WP_005751285.1.58628 WP_005751285.1.58910 WP_005751285.1.59455 WP_005751285.1.60478 WP_005751285.1.60664 WP_005751285.1.61098 WP_005751285.1.61860 WP_005751285.1.62016 WP_005751285.1.6219 WP_005751285.1.62389 WP_005751285.1.6332 WP_005751285.1.63549 WP_005751285.1.65878 WP_005751285.1.66934 WP_005751285.1.66990 WP_005751285.1.72215 WP_005751285.1.73917 WP_005751285.1.74955 WP_005751285.1.75804 WP_005751285.1.78987 WP_005751285.1.79347 WP_005751285.1.79593 WP_005751285.1.80223 WP_005751285.1.80589 WP_005751285.1.80911 WP_005751285.1.81885 WP_005751285.1.8281 WP_005751285.1.83579 WP_005751285.1.87897 WP_005751285.1.88402 WP_005751285.1.89773 WP_005751285.1.90081 WP_005751285.1.90179 WP_005751285.1.90578 WP_005751285.1.91495 WP_005751285.1.92478 WP_005751285.1.93940 WP_005751285.1.94432 WP_005751285.1.94435 WP_005751285.1.95718 WP_005751285.1.9746 WP_005751285.1.9947 gi|386834513|ref|YP_006239829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]