SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602268|ref|NP_245340.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602268|ref|NP_245340.1|
Domain Number 1 Region: 92-286
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.44e-26
Family Phosphate binding protein-like 0.005
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-18
Family LysR-like transcriptional regulators 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602268|ref|NP_245340.1|
Sequence length 289
Comment protein HpkR [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MYNLEQLKAFVAVCENGSISAAARKLGKAQSAVSSAVANLEIALNQTLFDRSKNAAHLTS
NGAALLPMVKHVLQQIHYFEQKATALSEPQEYRLSIAFEDTLWDEQLTKIFVKLHQRFPH
TQLDLQLSTAAEIRSKIEQGELNIGILYQNQVQSDLPVQLLGQQRFVAAAAPSHPLSQLT
EVNNADLAHFVQLIHRNADITPISPQYWQINSYYLMMDLVNQGIGWAIMPEQLLVDEFLG
SQLNRLPLTALLHPKPLDITAMTAFNHYHGKVTQFVLAELKEVFHTQRS
Download sequence
Identical sequences Q9CNM4
272843.PM0403 WP_010906626.1.12311 WP_010906626.1.15732 WP_010906626.1.40210 WP_010906626.1.45422 WP_010906626.1.4808 WP_010906626.1.53852 WP_010906626.1.6219 WP_010906626.1.62389 WP_010906626.1.66990 WP_010906626.1.81885 WP_010906626.1.8281 WP_010906626.1.89773 WP_010906626.1.9746 WP_010906626.1.9947 gi|15602268|ref|NP_245340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]