SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602282|ref|NP_245354.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602282|ref|NP_245354.1|
Domain Number 1 Region: 87-212
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 1.96e-23
Family LexA-related 0.0068
Further Details:      
 
Domain Number 2 Region: 7-62
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000256
Family Excisionase-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602282|ref|NP_245354.1|
Sequence length 216
Comment hypothetical protein PM0417 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MEKNLYLPGSDKGIVKKAAREGWQKRQRQGVKGKTFEYHYTSFPIAVQQQLGLYQAEQPH
SQVNEPRRHYTTEVSSIENTQTEDHIPIPFYACFSAFTSSAKANQHITLMKDWLTGRGIT
ADKLVFVSATGDSMLPTIHHGDLLLINREVNSAKEEGIYVIRSGKQVWIKRIQGLPNGIR
LMSDNKTLYPPIDLSFEQYHALEIIGKVIFIGHHLI
Download sequence
Identical sequences Q9CNL1
gi|15602282|ref|NP_245354.1| 272843.PM0417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]