SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602294|ref|NP_245366.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602294|ref|NP_245366.1|
Domain Number 1 Region: 10-420
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-141
Family Tandem AAA-ATPase domain 0.000000000364
Further Details:      
 
Domain Number 2 Region: 42-87,464-585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-37
Family Tandem AAA-ATPase domain 0.00000423
Further Details:      
 
Domain Number 3 Region: 633-674
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000000000602
Family C-terminal UvrC-binding domain of UvrB 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602294|ref|NP_245366.1|
Sequence length 678
Comment excinuclease ABC subunit B [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAYKMHTKSFILHSDFSPSGDQPQAITQLIEGLENGLAHQTLLGVTGSGKTFTIANVIAK
LNRPAMVLAPNKTLAAQLYAEMKAFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASI
NDQIEQMRLSATKSFLERRDTIVVASVSAIYGLGDPDSYLKMMLHLQTGAIINQRQILAQ
LAELQYTRNDQAFERGTFRVRGEIIDIFPAESDDKAIRIELFDDEIERLSLFDPLTGSSF
GPVPRYTIYPKTHYVTPRERILNAIEKIKQELAERRQFLLENNKLLEEQRITQRTQFDIE
MMNELGYCSGIENYSRYLSGRNEGEPPPTLFDYMPSDALLIIDESHVTVPQIGGMYRGDR
SRKETLVEYGFRLPSALDNRPLRFEEFERLAPQTIYVSATPGPYELEKSGGEIIDQVVRP
TGLLDPEIEIRPVAIQVDDLLSEARQRADQNERVLVTTLTKKMAEDLTDYLDEHGIRVRY
LHSDIDTVERVEIIRDLRLGEFDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSL
IQTIGRAARNLKGKAILYADRITNSMQKAITETNRRREKQMKYNEARGIVPQALNKKVGE
LLDIGQGANQKAKANRNAKKVAEPTALYVVPQTAKEYQQQIKKLEQQMYKYAQDLEFEKA
AAVRDQLQQLREHFFEVQ
Download sequence
Identical sequences P57844
WP_010906640.1.12311 WP_010906640.1.15732 WP_010906640.1.19996 WP_010906640.1.40210 WP_010906640.1.45422 WP_010906640.1.4808 WP_010906640.1.53852 WP_010906640.1.6219 WP_010906640.1.62389 WP_010906640.1.66990 WP_010906640.1.81885 WP_010906640.1.8281 WP_010906640.1.89773 WP_010906640.1.9746 WP_010906640.1.9947 272843.PM0429 gi|15602294|ref|NP_245366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]