SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602303|ref|NP_245375.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602303|ref|NP_245375.1|
Domain Number 1 Region: 400-601
Classification Level Classification E-value
Superfamily FtsH protease domain-like 9.42e-75
Family FtsH protease domain-like 0.00000385
Further Details:      
 
Domain Number 2 Region: 140-389
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.95e-72
Family Extended AAA-ATPase domain 0.00000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602303|ref|NP_245375.1|
Sequence length 639
Comment hypothetical protein PM0438 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MVKNLVLWIVVAVVMMTAYQGFNSSSSGNTTDYTTFITDLGNDQIRQARFDYNEIFVTKT
DGSKYTTVMPLNDDKLLNDLLNKKVKVEGTLPEKRGLFSQILISWFPMLLLIGVWFFFMR
QMQGGGSKAMSFGKSRARMMTQEQIKTTFADVAGCDEAKEEVGEIVDFLRDPGKFQKLGG
KIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
NAPCLIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGVIVIAATNRPDV
LDPALTRPGRFDRQVVVGLPDVRGREQILKVHMRRVPIAPDVDAMTLARGTPGYSGADLA
NLVNEAALFAARTNKRLVTMLEFEKAKDKINMGPERRTMIMTEKQKESTAYHEAGHAIVG
YLVPEHDPVHKVTIIPRGRALGVTFFLPEGDQVSISQKQLESKLSTLYAGRLAEDLIYGE
ENISTGASNDIKVATNIARNMVTQWGFSEKLGPILYSEDDGEVFLGRSMAKAKHMSDETA
HLIDEEVRTIVTRNYERARQILIDNMDILHAMKDALVKYETIEEEQIEQLMKRQPVTPPS
GWDENEPTTQNNAGTKASPEPKSAVETEQDSDHQSPSDK
Download sequence
Identical sequences Q9CNJ2
gi|15602303|ref|NP_245375.1| 272843.PM0438 WP_010906646.1.66990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]