SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602307|ref|NP_245379.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602307|ref|NP_245379.1|
Domain Number 1 Region: 28-216
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00000000654
Family Apolipoprotein A-I 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602307|ref|NP_245379.1|
Sequence length 229
Comment hypothetical protein PM0442 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKSVLAALVLGASLSVTGCFDKESKAGQEVEKAKASVVETKEAVVNAANEVKNSAVEAA
KEAKETVATKVEEVKETTAAKVEEVKAATAAKVEEMKETTAAKVEEMKEASAAKMEEVKA
ATATKMEEMKAAVADAKNDVAEKAAEVKDAAAAKAEEAKAAVAEKSAEMKDAAAAKVEDA
KVASSEAKEMVTEKATEMKDAMKAEVNKAADAVSEKTEEVKEVIVPKAQ
Download sequence
Identical sequences A0A1D7R144 Q9CNI8 V4NEH8
WP_005756287.1.10027 WP_005756287.1.10721 WP_005756287.1.11014 WP_005756287.1.12311 WP_005756287.1.1307 WP_005756287.1.15732 WP_005756287.1.17217 WP_005756287.1.18123 WP_005756287.1.19996 WP_005756287.1.20287 WP_005756287.1.22153 WP_005756287.1.2313 WP_005756287.1.23830 WP_005756287.1.26616 WP_005756287.1.27416 WP_005756287.1.27592 WP_005756287.1.29697 WP_005756287.1.30617 WP_005756287.1.34253 WP_005756287.1.35978 WP_005756287.1.39152 WP_005756287.1.40210 WP_005756287.1.41297 WP_005756287.1.41462 WP_005756287.1.41657 WP_005756287.1.42469 WP_005756287.1.42512 WP_005756287.1.42943 WP_005756287.1.44741 WP_005756287.1.45422 WP_005756287.1.47685 WP_005756287.1.4808 WP_005756287.1.52066 WP_005756287.1.53852 WP_005756287.1.57420 WP_005756287.1.57956 WP_005756287.1.58450 WP_005756287.1.58628 WP_005756287.1.58910 WP_005756287.1.59455 WP_005756287.1.60664 WP_005756287.1.61860 WP_005756287.1.62016 WP_005756287.1.6219 WP_005756287.1.62389 WP_005756287.1.65482 WP_005756287.1.65878 WP_005756287.1.66934 WP_005756287.1.66990 WP_005756287.1.73917 WP_005756287.1.74955 WP_005756287.1.75804 WP_005756287.1.80223 WP_005756287.1.80589 WP_005756287.1.80911 WP_005756287.1.81885 WP_005756287.1.8281 WP_005756287.1.86541 WP_005756287.1.87897 WP_005756287.1.89773 WP_005756287.1.90081 WP_005756287.1.90179 WP_005756287.1.90578 WP_005756287.1.91495 WP_005756287.1.94432 WP_005756287.1.94435 WP_005756287.1.9746 272843.PM0442 gi|378774154|ref|YP_005176397.1| gi|15602307|ref|NP_245379.1| gi|383310078|ref|YP_005362888.1| gi|386834444|ref|YP_006239760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]