SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602339|ref|NP_245411.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602339|ref|NP_245411.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.7e-20
Family Universal stress protein-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602339|ref|NP_245411.1|
Sequence length 140
Comment hypothetical protein PM0474 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFKKILITADLGHLEDAEKAVKTALEMTQNNPDTVYRVMSVVPPFGSSFVSSFLPKNFDQ
DVLSEANKALHAFTKKHFPEGAKVQHILAHGPVYEEIIRIAKEKNIDLIIMMAVRDNKEG
LSSNTVKVARYSDKPVLILR
Download sequence
Identical sequences A0A1E3XIT1 Q9CNF8 V4N8Z0
gi|378774186|ref|YP_005176429.1| 272843.PM0474 gi|15602339|ref|NP_245411.1| WP_005721812.1.10027 WP_005721812.1.10721 WP_005721812.1.11014 WP_005721812.1.11214 WP_005721812.1.11947 WP_005721812.1.12156 WP_005721812.1.12311 WP_005721812.1.1307 WP_005721812.1.14908 WP_005721812.1.15732 WP_005721812.1.17217 WP_005721812.1.17980 WP_005721812.1.18123 WP_005721812.1.19996 WP_005721812.1.20287 WP_005721812.1.21657 WP_005721812.1.22153 WP_005721812.1.2313 WP_005721812.1.23830 WP_005721812.1.24757 WP_005721812.1.26616 WP_005721812.1.26777 WP_005721812.1.27416 WP_005721812.1.28084 WP_005721812.1.29697 WP_005721812.1.30617 WP_005721812.1.34253 WP_005721812.1.35562 WP_005721812.1.35978 WP_005721812.1.36022 WP_005721812.1.3807 WP_005721812.1.38246 WP_005721812.1.3839 WP_005721812.1.39152 WP_005721812.1.3957 WP_005721812.1.40210 WP_005721812.1.40787 WP_005721812.1.41351 WP_005721812.1.41462 WP_005721812.1.41667 WP_005721812.1.42469 WP_005721812.1.42943 WP_005721812.1.43687 WP_005721812.1.44741 WP_005721812.1.45422 WP_005721812.1.47685 WP_005721812.1.4808 WP_005721812.1.49053 WP_005721812.1.50853 WP_005721812.1.51342 WP_005721812.1.52066 WP_005721812.1.52585 WP_005721812.1.52859 WP_005721812.1.53852 WP_005721812.1.55074 WP_005721812.1.55401 WP_005721812.1.57420 WP_005721812.1.58111 WP_005721812.1.58257 WP_005721812.1.58450 WP_005721812.1.58628 WP_005721812.1.58910 WP_005721812.1.59455 WP_005721812.1.60478 WP_005721812.1.60664 WP_005721812.1.61098 WP_005721812.1.61860 WP_005721812.1.62016 WP_005721812.1.6219 WP_005721812.1.62389 WP_005721812.1.6332 WP_005721812.1.63549 WP_005721812.1.65482 WP_005721812.1.65878 WP_005721812.1.66934 WP_005721812.1.66990 WP_005721812.1.70689 WP_005721812.1.72215 WP_005721812.1.73917 WP_005721812.1.74955 WP_005721812.1.75804 WP_005721812.1.78987 WP_005721812.1.79347 WP_005721812.1.79593 WP_005721812.1.80223 WP_005721812.1.80589 WP_005721812.1.80911 WP_005721812.1.8281 WP_005721812.1.83579 WP_005721812.1.86541 WP_005721812.1.87897 WP_005721812.1.88402 WP_005721812.1.89773 WP_005721812.1.90081 WP_005721812.1.90179 WP_005721812.1.90578 WP_005721812.1.91495 WP_005721812.1.92478 WP_005721812.1.93940 WP_005721812.1.94435 WP_005721812.1.95718 WP_005721812.1.9746 WP_005721812.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]