SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602341|ref|NP_245413.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602341|ref|NP_245413.1|
Domain Number 1 Region: 164-263
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 0.000000000185
Family GTP cyclohydrolase I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602341|ref|NP_245413.1|
Sequence length 279
Comment 7-cyano-7-deazaguanine reductase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQYQHDSLDKLKLGQQTQYASNYDHTLLQPVPRHLNRDTLGITHTQPFHFGADIWTAYEI
SWLNLNGLPQVAIADVAIDFQSENLIESKSFKLYLNSFNQSKFATFEEVQQHLTQDLSNC
AKGKVSVKLHPLSKYCHEPIVELAGECIDQQDIEINDYQFNPEILTNCTHDQMVKESLVS
HLLKSNCLITNQPDWGTLQIRYEGKQIDREKLLRYIISFRQHNEFHEQCVERIFCDLMQF
AKPDKLTVYARYTRRGGLDINPFRSNFEAVPDNQRLARQ
Download sequence
Identical sequences Q9CNF6
WP_010906669.1.12311 WP_010906669.1.15732 WP_010906669.1.19996 WP_010906669.1.40210 WP_010906669.1.45422 WP_010906669.1.4808 WP_010906669.1.53852 WP_010906669.1.6219 WP_010906669.1.62389 WP_010906669.1.66990 WP_010906669.1.81885 WP_010906669.1.8281 WP_010906669.1.89773 WP_010906669.1.9746 WP_010906669.1.9947 272843.PM0476 gi|15602341|ref|NP_245413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]