SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602348|ref|NP_245420.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602348|ref|NP_245420.1|
Domain Number 1 Region: 356-549
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-28
Family ATP-dependent protease Lon (La), catalytic domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602348|ref|NP_245420.1|
Sequence length 596
Comment hypothetical protein PM0483 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNPSFLAEKALSWQELRPELQLTELPHSSLDFFALQQRASAAVNQFLHNPHRHLCVLKAD
EQGEYAHLLEQFVASQQQHDDRVHGVQYLVEQGDSFSFPRIFMEVAQNQNDNFAAKRKVA
SALYVDQFQLLGSIRIHPSSQEIQLNPGLVHQLNGGVLILGVGSLINQFDLWIRLKQLLL
TQRFDWYSAHPFKALPCDIPSYPLSLKVILLGNREELATLAELDADLYDLADYSEIESYY
AIESAEQRMKWAEYVQSMASYHQLPQLTLDGLNKLYQLLVRESEDRAFVSISPLKLKAIL
SGSAILKQKDTNALLSAVDFEQFFQQKEMQQSFLKEHTYSDILHEQVYVATEGDIVGQIN
GLSVIEYPGTPMAFGEPSRISCIVQFGDGEVVDVERKSELAGNIHGKSIMIAQACLAHTL
GFPSQLPFSASLVFEQSYGEIDGDSASLASFCVLASALADYPLPQSIAITGAIDQFGLVH
SVGGVNAKIEGFFSICARRGLTGQQGVMVPSTVIHQLSLSEDVVNAVKAGQFFIYPVEDV
YQACHILFQRDLVEETGKVYSEVDLPLSRLIAIRIEQRAEQQLYKTSVWDWLLRKR
Download sequence
Identical sequences Q9CNE9
272843.PM0483 WP_010906673.1.12311 WP_010906673.1.15732 WP_010906673.1.19996 WP_010906673.1.40210 WP_010906673.1.4808 WP_010906673.1.53852 WP_010906673.1.6219 WP_010906673.1.62389 WP_010906673.1.66990 WP_010906673.1.81885 WP_010906673.1.8281 WP_010906673.1.89773 WP_010906673.1.9746 WP_010906673.1.9947 gi|15602348|ref|NP_245420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]