SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602351|ref|NP_245423.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602351|ref|NP_245423.1|
Domain Number 1 Region: 131-306
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.96e-31
Family GAPDH-like 0.0021
Further Details:      
 
Domain Number 2 Region: 5-156
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.86e-27
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602351|ref|NP_245423.1|
Sequence length 324
Comment aspartate-semialdehyde dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNATLNVAIAAEFELSEKIAETLEESQLNISQLSIVEIYPFNEEQGIRFHNKSVVQLKPE
EVEWSSIHYLFFAGDIQQVAHLAKAAEMGCVVIDMKGICASLQDVPVVIPGVNQEKLVDL
RQRNIVSLADPQVTQLALAIAPLMSNHEIKDIAVTSLLPASYTNGETVSKLAGQTARLLN
GIPLDEGEQRLAFDVFPTPASHLNTQIHKIFPQLDNVVFHSIQVPVFYGMGQMVSVLSDY
ALAPQSCLASWADNPLMTYHAEKYCTPVTNGEQEMAEEQAAKLHISGLSAVENGLQFWSV
ADEQRFNLALLSVTLAELIYSQGY
Download sequence
Identical sequences Q9CNE6
272843.PM0486 WP_010906675.1.12311 WP_010906675.1.15732 WP_010906675.1.19996 WP_010906675.1.40210 WP_010906675.1.45422 WP_010906675.1.4808 WP_010906675.1.53852 WP_010906675.1.6219 WP_010906675.1.62389 WP_010906675.1.66990 WP_010906675.1.81885 WP_010906675.1.8281 WP_010906675.1.89773 WP_010906675.1.9746 WP_010906675.1.9947 gi|15602351|ref|NP_245423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]