SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602380|ref|NP_245452.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602380|ref|NP_245452.1|
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily DsrEFH-like 1.31e-30
Family DsrEF-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602380|ref|NP_245452.1|
Sequence length 119
Comment hypothetical protein PM0515 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MMKKFLFIISAAPYGNENFFSALRLALQLQEQHKSAVEIKLFLMSDAVTGGLAKQNPAEG
YHLQQALEILTAQGAQVKLCKTCTNARGITELPLAEGVEIGTLSELADWTFAADNVLNF
Download sequence
Identical sequences Q9CNB7
gi|15602380|ref|NP_245452.1| 272843.PM0515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]