SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602386|ref|NP_245458.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602386|ref|NP_245458.1|
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-49
Family Translational machinery components 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602386|ref|NP_245458.1|
Sequence length 130
Comment 30S ribosomal protein S9 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAENQNYGTGRRKSSSARVFIKPGSGKITINQRDLDVYFGRETARMIVRQPLELVEMTEK
LDLYVTVKGGGISGQAGAIRHGITRALIEYDESLRSVLRAAGFVTRDARQVERKKVGLRK
ARRRPQFSKR
Download sequence
Identical sequences A0A1E3XJG6 A0A2K2YZI4 Q9CNB1 V4PXM2
272843.PM0521 gi|15602386|ref|NP_245458.1| WP_005721962.1.10027 WP_005721962.1.10721 WP_005721962.1.11014 WP_005721962.1.11214 WP_005721962.1.11947 WP_005721962.1.12156 WP_005721962.1.12311 WP_005721962.1.1307 WP_005721962.1.14908 WP_005721962.1.15732 WP_005721962.1.17217 WP_005721962.1.17980 WP_005721962.1.18123 WP_005721962.1.19996 WP_005721962.1.20287 WP_005721962.1.21657 WP_005721962.1.22153 WP_005721962.1.2313 WP_005721962.1.23830 WP_005721962.1.24757 WP_005721962.1.26616 WP_005721962.1.26777 WP_005721962.1.27416 WP_005721962.1.27592 WP_005721962.1.27664 WP_005721962.1.28084 WP_005721962.1.29202 WP_005721962.1.29697 WP_005721962.1.30617 WP_005721962.1.34253 WP_005721962.1.35562 WP_005721962.1.35978 WP_005721962.1.36022 WP_005721962.1.3807 WP_005721962.1.38246 WP_005721962.1.3839 WP_005721962.1.39152 WP_005721962.1.3957 WP_005721962.1.40210 WP_005721962.1.40787 WP_005721962.1.41297 WP_005721962.1.41351 WP_005721962.1.41462 WP_005721962.1.41657 WP_005721962.1.41667 WP_005721962.1.4211 WP_005721962.1.42469 WP_005721962.1.42512 WP_005721962.1.42943 WP_005721962.1.43687 WP_005721962.1.44741 WP_005721962.1.45422 WP_005721962.1.47685 WP_005721962.1.4808 WP_005721962.1.49053 WP_005721962.1.50853 WP_005721962.1.51342 WP_005721962.1.52066 WP_005721962.1.52585 WP_005721962.1.52859 WP_005721962.1.53852 WP_005721962.1.55074 WP_005721962.1.55401 WP_005721962.1.57420 WP_005721962.1.57956 WP_005721962.1.58111 WP_005721962.1.58257 WP_005721962.1.58450 WP_005721962.1.58628 WP_005721962.1.58910 WP_005721962.1.59455 WP_005721962.1.60478 WP_005721962.1.60664 WP_005721962.1.61098 WP_005721962.1.61860 WP_005721962.1.62016 WP_005721962.1.6219 WP_005721962.1.62389 WP_005721962.1.6332 WP_005721962.1.63549 WP_005721962.1.65482 WP_005721962.1.65878 WP_005721962.1.66934 WP_005721962.1.66990 WP_005721962.1.70689 WP_005721962.1.72215 WP_005721962.1.73917 WP_005721962.1.74955 WP_005721962.1.75804 WP_005721962.1.78987 WP_005721962.1.79347 WP_005721962.1.79593 WP_005721962.1.80223 WP_005721962.1.80589 WP_005721962.1.80911 WP_005721962.1.81885 WP_005721962.1.8281 WP_005721962.1.83579 WP_005721962.1.86541 WP_005721962.1.87897 WP_005721962.1.88402 WP_005721962.1.89773 WP_005721962.1.90081 WP_005721962.1.90179 WP_005721962.1.90578 WP_005721962.1.91495 WP_005721962.1.92478 WP_005721962.1.93940 WP_005721962.1.94432 WP_005721962.1.94435 WP_005721962.1.95718 WP_005721962.1.9746 WP_005721962.1.9947 gi|378774226|ref|YP_005176469.1| gi|383310160|ref|YP_005362970.1| gi|386834363|ref|YP_006239678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]