SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602400|ref|NP_245472.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602400|ref|NP_245472.1|
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily THUMP domain-like 1.2e-46
Family THUMP domain 0.0025
Further Details:      
 
Domain Number 2 Region: 174-372
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.31e-42
Family ThiI-like 0.00024
Further Details:      
 
Domain Number 3 Region: 399-478
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000521
Family Single-domain sulfurtransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602400|ref|NP_245472.1|
Sequence length 480
Comment thiamine biosynthesis protein ThiI [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKFVIKLFPEIMIKSESVRKRFVKILTGNIRNILTKHDETIAVVRHWDYIEVRSKKEENR
PHLIELLGRIPGIHHFLEVDEKPFTTIHDIFEQTLQDIGTSLENKTFCVRVRRKGKHTFN
SLDVERYVGGGLNQHIPSAKVQLSKPDVTVRIDIENDNMMLIKARHVGIGGYPIGTQEDV
LSLISGGFDSGVSSYMLIRRGSRVHYCFFNLGGAAHEIGVKQMAYHIWQRYSASHKVRFV
AINFEGVVGEILEKVDNGQMGVVLKRMMVRAASRIAERFGIQAIVTGEALGQVSSQTLTN
LRLIDEASESLVLRPLITHDKEQIIAMAKEIGTDDIAKSMPEFCGVISKNPTVKAIKAKI
EQEERHFDFAVLESAVQNAQYLDIRQIAEQTEKEVVAVDTVAVLSAQDVILDIRSPEETD
EKPLNMENVQLMPFYKLSSQFANLDQSKNYLLYCERGVMSKLQALYLKEQGFSNVKVFRQ
Download sequence
Identical sequences A0A2J9R4G0 P57849
gi|15602400|ref|NP_245472.1| 272843.PM0535 WP_005753929.1.12311 WP_005753929.1.14908 WP_005753929.1.15732 WP_005753929.1.19996 WP_005753929.1.24757 WP_005753929.1.3957 WP_005753929.1.40210 WP_005753929.1.40787 WP_005753929.1.41351 WP_005753929.1.41667 WP_005753929.1.45422 WP_005753929.1.4808 WP_005753929.1.53852 WP_005753929.1.58111 WP_005753929.1.61098 WP_005753929.1.6219 WP_005753929.1.62389 WP_005753929.1.66990 WP_005753929.1.81885 WP_005753929.1.8281 WP_005753929.1.88402 WP_005753929.1.89773 WP_005753929.1.92478 WP_005753929.1.93940 WP_005753929.1.9746 WP_005753929.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]