SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602412|ref|NP_245484.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602412|ref|NP_245484.1|
Domain Number 1 Region: 60-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.73e-96
Family L-arabinose binding protein-like 0.0000000563
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.03e-17
Family GalR/LacI-like bacterial regulator 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602412|ref|NP_245484.1|
Sequence length 334
Comment DNA-binding transcriptional repressor PurR [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MATIKDVAKMAGVSTTTVSHVINKTRFVAAETEKLVLQAIQELNYSPSAVARSLKVNTTK
SIGMIVTSSEAPYFAEIIHAVEEHCYRQGYSLFLCNTQNNVEKIKNHLEMLIKKRVDGIL
VMCAEYTQDSLDLLANFTSLPLVVMDWGPDNKHTDIIQDHSFEGGYLATKYLIDHGHKDI
GIIAGELTKTTAKTRYEGFIKAMNEAGLKINPDWVMEGFFEPEDGYECMNKILAQDTLPT
AVFCCNDVMALGAISAIGEKGLRVPEDISIIGYDNIHASRFYSPPLTTIHQSKSRLGARA
VTLLFERINEKSEERAVIEMHPELVIRKSVKSRL
Download sequence
Identical sequences A0A1E3XKR5 Q9CN88 V4N6N5
gi|378774256|ref|YP_005176499.1| gi|383310190|ref|YP_005363000.1| gi|386834332|ref|YP_006239647.1| gi|15602412|ref|NP_245484.1| 272843.PM0547 WP_005722015.1.10027 WP_005722015.1.10721 WP_005722015.1.11014 WP_005722015.1.11214 WP_005722015.1.11947 WP_005722015.1.12156 WP_005722015.1.12311 WP_005722015.1.1307 WP_005722015.1.15732 WP_005722015.1.17217 WP_005722015.1.17980 WP_005722015.1.18123 WP_005722015.1.19996 WP_005722015.1.20287 WP_005722015.1.21657 WP_005722015.1.22153 WP_005722015.1.2313 WP_005722015.1.23830 WP_005722015.1.24757 WP_005722015.1.26616 WP_005722015.1.27416 WP_005722015.1.27592 WP_005722015.1.28084 WP_005722015.1.29697 WP_005722015.1.30617 WP_005722015.1.34253 WP_005722015.1.35562 WP_005722015.1.35978 WP_005722015.1.36022 WP_005722015.1.3807 WP_005722015.1.38246 WP_005722015.1.3839 WP_005722015.1.39152 WP_005722015.1.40210 WP_005722015.1.40787 WP_005722015.1.41297 WP_005722015.1.41351 WP_005722015.1.41462 WP_005722015.1.41657 WP_005722015.1.41667 WP_005722015.1.42469 WP_005722015.1.42512 WP_005722015.1.42943 WP_005722015.1.43687 WP_005722015.1.44741 WP_005722015.1.47685 WP_005722015.1.4808 WP_005722015.1.50853 WP_005722015.1.51342 WP_005722015.1.52066 WP_005722015.1.52585 WP_005722015.1.52859 WP_005722015.1.53852 WP_005722015.1.55074 WP_005722015.1.55401 WP_005722015.1.57420 WP_005722015.1.57956 WP_005722015.1.58111 WP_005722015.1.58257 WP_005722015.1.58450 WP_005722015.1.58628 WP_005722015.1.58910 WP_005722015.1.59455 WP_005722015.1.60478 WP_005722015.1.60664 WP_005722015.1.61860 WP_005722015.1.62016 WP_005722015.1.6219 WP_005722015.1.62389 WP_005722015.1.6332 WP_005722015.1.63549 WP_005722015.1.65482 WP_005722015.1.65878 WP_005722015.1.66934 WP_005722015.1.66990 WP_005722015.1.70689 WP_005722015.1.72215 WP_005722015.1.73917 WP_005722015.1.74955 WP_005722015.1.75804 WP_005722015.1.78987 WP_005722015.1.79347 WP_005722015.1.79593 WP_005722015.1.80223 WP_005722015.1.80589 WP_005722015.1.80911 WP_005722015.1.81885 WP_005722015.1.8281 WP_005722015.1.83579 WP_005722015.1.86541 WP_005722015.1.87897 WP_005722015.1.88402 WP_005722015.1.89773 WP_005722015.1.90081 WP_005722015.1.90179 WP_005722015.1.90578 WP_005722015.1.91495 WP_005722015.1.92478 WP_005722015.1.93940 WP_005722015.1.94432 WP_005722015.1.94435 WP_005722015.1.95718 WP_005722015.1.9746 WP_005722015.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]