SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602413|ref|NP_245485.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602413|ref|NP_245485.1|
Domain Number 1 Region: 1-271
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.66e-39
Family Tyrosine-dependent oxidoreductases 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602413|ref|NP_245485.1|
Sequence length 295
Comment hypothetical protein PM0548 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNILITGATGLIGSHLTSQLIKHAHGVTALVRDPKAAKQKLPASVTLISSLAQYTTLDTF
DAVINLAGEPIFEKRWTAQQKQRLVESRVNLTAQLVQRINASRTPPHTFISGSATGYYGH
NAEEIITENAPATDTFPSQLCQRWESEALCAKTRVCLLRTGIVLSKTGGALAKMLPLYRL
GLGGKLGSGKQYWAWIALDDMVKGILFLLENHQCQGAFNLVSPNPVRHVEFNNTLANILK
RPAFATVPELLLRFFLGERTQLLLDSQKIVPEKLLAQGFVFDYPELKSALQAILK
Download sequence
Identical sequences Q9CN87
WP_005726337.1.12311 WP_005726337.1.15732 WP_005726337.1.19996 WP_005726337.1.40210 WP_005726337.1.41351 WP_005726337.1.41667 WP_005726337.1.45422 WP_005726337.1.4808 WP_005726337.1.53852 WP_005726337.1.58111 WP_005726337.1.6219 WP_005726337.1.62389 WP_005726337.1.66990 WP_005726337.1.70689 WP_005726337.1.81885 WP_005726337.1.8281 WP_005726337.1.88402 WP_005726337.1.89773 WP_005726337.1.92478 WP_005726337.1.93940 WP_005726337.1.9746 WP_005726337.1.9947 272843.PM0548 gi|15602413|ref|NP_245485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]