SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602414|ref|NP_245486.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602414|ref|NP_245486.1|
Domain Number 1 Region: 28-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-20
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 106-175
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 1.44e-19
Family C-terminal domain of arginine repressor 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602414|ref|NP_245486.1|
Sequence length 180
Comment arginine repressor [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAEFICIFMQIYARSLHYLVKGTPTMNYEKQDNLLNAFKELLAQERFGSQSEIVQALQEL
GFTQINQSKVSRMLTKFGAVRTRNTRMEMVYCLPNELSVPNTKSPLKNLVLDIDHNHFVV
VIRTTPGAAQLIARLLDSIGKADGILGTIAGDDTIFVTPTLDANIADLIKSIRNLFETSI
Download sequence
Identical sequences gi|15602414|ref|NP_245486.1| 272843.PM0549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]