SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602415|ref|NP_245487.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602415|ref|NP_245487.1|
Domain Number 1 Region: 146-310
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 1.85e-43
Family Lactate & malate dehydrogenases, C-terminal domain 0.000000705
Further Details:      
 
Domain Number 2 Region: 1-145
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.19e-38
Family LDH N-terminal domain-like 0.000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602415|ref|NP_245487.1|
Sequence length 311
Comment malate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKVAVLGAAGGIGQALALLLKLQLPAGSELSLYDIAPVTPGVAADVSHIPTAVKVQGFAG
EDPTPALQGADVVLISAGVARKPGMDRSDLFNINAGIVRNLIEKVAQVCPKACVGIITNP
VNTTVAIAAEVLKKAGVYDKRKLFGVTTLDIIRSETFVSELKNLEPARTTVPVIGGHSGV
TILPLLSQVQYAEWNDAEIAPLTKRIQNAGTEVVEAKAGGGSATLSMAQAAARFALSLVK
GLNGENVVECTYVEGDGKYARFFAQPVRLGKEGVEEILPLGSLSAFEQHALDAMLETLRA
DIELGEKFVNQ
Download sequence
Identical sequences Q9CN86
272843.PM0550 gi|15602415|ref|NP_245487.1| WP_010906720.1.12311 WP_010906720.1.15732 WP_010906720.1.19996 WP_010906720.1.40210 WP_010906720.1.45422 WP_010906720.1.4808 WP_010906720.1.53852 WP_010906720.1.6219 WP_010906720.1.62389 WP_010906720.1.66990 WP_010906720.1.81885 WP_010906720.1.8281 WP_010906720.1.89773 WP_010906720.1.9746 WP_010906720.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]